Entry information : MtPrx74 (Medtr4g087965.1[4.0])
Entry ID 399
Creation 2005-06-16 (Christophe Dunand)
Last sequence changes 2014-07-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-07-30 (Christophe Dunand)
Peroxidase information: MtPrx74 (Medtr4g087965.1[4.0])
Name (synonym) MtPrx74 (Medtr4g087965.1[4.0])
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Mycorrhizal roots
Inducers Glomus intraradices infection
Mycorrhiza
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx74
start..stop
S start..stop
GmPrx238 578 0 20..346 23..349
VuPrx02 576 0 9..346 1..336
RcPrx49 546 0 9..345 16..352
CsPrx13 540 0 9..346 17..355
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 34626731..34626991 261 N° 2 34627112..34627312 201 N° 3 34628646..34629224 579  
join(34626731..34626991,34627112..34627312,34628646..34629224)


exon

Literature and cross-references MtPrx74 (Medtr4g087965.1[4.0])
Literature Manthey,K. et al., unpublished.
DNA ref. GenBank:   CR302201 Phytozome 12:   chr4 (34626731..34629224)
Cluster/Prediction ref. Phytozome Gene 12:   31114501
Protein sequence: MtPrx74 (Medtr4g087965.1[4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346 (317)
PWM (Da):   %s   38322.54 (35117.0) Transmb domain:   %s   o10-32i
PI (pH):   %s   9.58 (9.78) Peptide Signal:   %s   cut: 30 range:30-346
Sequence 387
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSVTSSSLFVFTFSLFVFFILNETSSCLAMLSSKTTRIPRQLRVDYYAKSCPQVEQLVGSVTSQQFKQSPVSGPATIRLLFHDCFVEGCDASILIASKPGSKELAEKDAEDNKDLRMEGFETIRKAKEVVEKKCPTVVSCADILAIAARDFVHLAGGPYYQVKKGRWDGKISMASRVGSNIPRANSTVDELIKIFNSKGLTIQDMVALSGAHTIGFAHCKNFLTRLYNYRGKGQPDPDMNPKLLKALRMYCPNFGGNTDIVAPFDATTPFIFDHAYYGNLQNKMGLLASDQALALDPRTKSLVQDFAKDKQKFFQAFASAMDKMSLVKVVRGKKHGERRRDCSMHM

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, introns 1 and 2) and 1 EST .
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTCTGTGACTTCATCTTCTTTATTTGTTTTCACTTTTTCTTTGTTTGTTTTCTTCATTTTGAATGAAACTTCATCATGCTTAGCAATGCTTAGTAGCAAGACTACACGCATTCCTCGCC
AGCTTAGAGTTGATTACTACGCCAAATCTTGTCCACAGGTTGAACAGCTTGTTGGTTCAGTCACCTCTCAACAATTCAAACAATCACCTGTTTCTGGACCTGCCACCATTCGTCTCCTCT
TCCATGACTGCTTTGTAGAA
GTAAGCCAATTCCACACACGCACACACACAAACACAAATGTTTTTAGCTTTGCATGCAACTGTTGGTTTGTTTTCTTCAACCTCATTTTCAAGATTTCTG
GTTTGAATGAGTGAATGCAGGGTTGTGATGCATCAATTTTAATAGCATCAAAGCCAGGGAGCAAGGAGTTGGCAGAGAAAGATGCAGAGGATAATAAAGATTTGAGGATGGAGGGTTTTG
AGACTATAAGGAAGGCAAAAGAAGTGGTGGAGAAAAAGTGTCCTACTGTGGTGTCCTGTGCAGATATTCTTGCAATTGCAGCAAGAGATTTTGTGCACTTA
GTAAGTTACCTGTTCTTTG
TTTCAACTTCATATATAATGATTACCACTATTTTGATTTAATATATCTTCATATGTTTCCTTTATTCCAATCCTAATTTTTGGCTTCATTCTTGTACTTGTGGTGAGTACAATATCGACA
ACCAGGGTTTGGTATTTGTTTAGGTCATGCCCTGAAAATGATCTCATCCTCCTGAGTCGTAAGTCCTAACATTCTAAAATAAGGGCAGTTTGGTAATGCCCTCCAGTAGTGCATTAAGTT
TTGACATCAGGTCACATGCAATACAAGTACATAGTATCCCTAGTTTTGAAAGTTATTTTCTGATTTTTGATGTAACCATATTTGGCCCACTTAAATGGACAACAGAAAAGGGTAGAAATC
AATTAAAATTTAAAAGCTGTGAATCTTTATATATTTTGAGTGCAGGCTCAATTTTTTCTTGCATGTTCTCCTGCTGCATCTTTTTTGTTTCTTAGATAGCAGCTAGAAGAAACCATTTCT
AGATAAAATATGTGTTTTCCAACTTCACAGAATAACAGAGAAGCTTTATGAAAATACCAATTTAAATAAAAAGAAATGATTCTCAAACATTTAGGCCCTTGGTCTTTTGTTATATGAATA
GGAAAGCAGATTTCTTTATTATAATGTAAAAAGACAATATAGCCAAAAAAAAATATCCAACACCGTGACAAAAGAGCTAACATTATATTGTAGAATAAATTAATCTTTCCATTTGTTAAT
ATGTCTAGGTAAAATGACACAGAATACGCTAGACATTGTTACAGGCTGGTCATGATTCTATACTAACCAAAATCGTATTAACTTAGCTCTATAGATTAGAAATAGATAAATCCCAAGTTG
GTATTGGTTAAGAGTTTTTTCCTACATTAAAAATACAAAAATCTCACACTATAATATTAATTGTAGTTTTGGCAGTTAGCAGAGTGACTGTTTCATACAAGGGCTCTGCATAAAGTCAAA
TTGAATCTGTTTTCATGTTGTCATATACTGTTTGGTATATTGGACTCTAAAACAGCCGAATTTTTGTACTTTACCTTGAATTTTATTTAGACACCAATTACAACACCTGCTTCTTAATCT
TATAGGTCCAAGTCCAATTTTCAGTATTATTGTTCTTTTCTATGCAATATCATATCATATCTACATGTAGCAGCTTAACACTATGAAAGAATAAAAAAGTTCAATTAACGAAATCAGATA
AAAACTATAAACAAAACACTAAGAAATGGTTAATTATGTTGAGTTTATATTATGTTCTGTTAAGAAATGGCTAATTATATTTGGTTTAATTTTAGTATGTCATGTGTGACACAGGCAGGG
GGACCCTATTATCAAGTGAAGAAGGGAAGATGGGATGGAAAGATATCAATGGCATCAAGGGTAGGGTCAAACATCCCCCGTGCAAACTCAACCGTTGATGAGCTCATCAAAATCTTCAAT
TCAAAAGGCTTAACCATACAGGACATGGTTGCTCTTTCTGGTGCCCACACAATTGGATTTGCTCATTGCAAGAACTTTTTAACCCGCCTCTACAATTACCGAGGCAAGGGTCAACCCGAT
CCGGATATGAATCCTAAACTATTGAAAGCTCTTAGGATGTACTGCCCAAATTTTGGTGGAAACACAGACATTGTTGCCCCATTTGATGCAACTACTCCTTTCATATTTGACCATGCATAT
TATGGTAACTTGCAGAACAAGATGGGGTTGCTAGCATCTGACCAAGCTTTGGCTTTGGATCCACGAACCAAGTCACTGGTTCAAGATTTTGCAAAGGATAAACAAAAGTTTTTTCAAGCT
TTTGCATCTGCTATGGACAAAATGAGTTTAGTGAAAGTTGTGAGAGGAAAAAAGCATGGGGAGAGAAGGAGAGATTGTAGCATGCATATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTCTGTGACTTCATCTTCTTTATTTGTTTTCACTTTTTCTTTGTTTGTTTTCTTCATTTTGAATGAAACTTCATCATGCTTAGCAATGCTTAGTAGCAAGACTACACGCATTCCTCGCC
AGCTTAGAGTTGATTACTACGCCAAATCTTGTCCACAGGTTGAACAGCTTGTTGGTTCAGTCACCTCTCAACAATTCAAACAATCACCTGTTTCTGGACCTGCCACCATTCGTCTCCTCT
TCCATGACTGCTTTGTAGAA
GGTTGTGATGCATCAATTTTAATAGCATCAAAGCCAGGGAGCAAGGAGTTGGCAGAGAAAGATGCAGAGGATAATAAAGATTTGAGGATGGAGGGTTTTG
AGACTATAAGGAAGGCAAAAGAAGTGGTGGAGAAAAAGTGTCCTACTGTGGTGTCCTGTGCAGATATTCTTGCAATTGCAGCAAGAGATTTTGTGCACTTA
GCAGGGGGACCCTATTATC
AAGTGAAGAAGGGAAGATGGGATGGAAAGATATCAATGGCATCAAGGGTAGGGTCAAACATCCCCCGTGCAAACTCAACCGTTGATGAGCTCATCAAAATCTTCAATTCAAAAGGCTTAA
CCATACAGGACATGGTTGCTCTTTCTGGTGCCCACACAATTGGATTTGCTCATTGCAAGAACTTTTTAACCCGCCTCTACAATTACCGAGGCAAGGGTCAACCCGATCCGGATATGAATC
CTAAACTATTGAAAGCTCTTAGGATGTACTGCCCAAATTTTGGTGGAAACACAGACATTGTTGCCCCATTTGATGCAACTACTCCTTTCATATTTGACCATGCATATTATGGTAACTTGC
AGAACAAGATGGGGTTGCTAGCATCTGACCAAGCTTTGGCTTTGGATCCACGAACCAAGTCACTGGTTCAAGATTTTGCAAAGGATAAACAAAAGTTTTTTCAAGCTTTTGCATCTGCTA
TGGACAAAATGAGTTTAGTGAAAGTTGTGAGAGGAAAAAAGCATGGGGAGAGAAGGAGAGATTGTAGCATGCATATGTGA

Retrieve as FASTA