Entry information : MtPrx75 (Medtr6g043460.1[4.0] / contig_84121_2.1 [3.5])
Entry ID 400
Creation 2005-06-16 (Christophe Dunand)
Last sequence changes 2014-07-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-07-30 (Christophe Dunand)
Peroxidase information: MtPrx75 (Medtr6g043460.1[4.0] / contig_84121_2.1 [3.5])
Name (synonym) MtPrx75 (Medtr6g043460.1[4.0] / contig_84121_2.1 [3.5])
Class Class III peroxidase    [Orthogroup: Prx260]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Roots
Inducers Elicitor treatment (glucan, oligosaccharides, yeast extract, Phytophthora crude extract)
Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx75
start..stop
S start..stop
GmPrx36 459 1.21e-163 33..344 31..341
PvPrx16 427 1.31e-150 21..328 24..334
GmPrx32 408 2.6e-143 1..348 2..352
PvPrx14 400 2.32e-140 1..348 1..350
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '400' 'complement(join(15050121..15050729,15050900..15051094,15051843..15052085))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15051843..15052085 241 N° 2 15050900..15051094 193 N° 3 15050121..15050729 607  
complement(join(15050121..15050729,15050900..15051094,15051843..15052085))


exon

Literature and cross-references MtPrx75 (Medtr6g043460.1[4.0] / contig_84121_2.1 [3.5])
Literature Cote,F. et al., unpublished
DNA ref. Phytozome 12:   chr6 (15052085..15050121)
Cluster/Prediction ref. Phytozome Gene 12:   31104031 UniGene:   Mtr.9983
Omic ref. Gene atlas:   Mtr.38549.1.S1_at Legoo:   Mtr.38549.1.S1_at
Protein sequence: MtPrx75 (Medtr6g043460.1[4.0] / contig_84121_2.1 [3.5])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (324)
PWM (Da):   %s   38586.61 (36062.2)  
PI (pH):   %s   5.45 (5.27) Peptide Signal:   %s   cut: 25 range:25-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMVSASRSLFISFLLASLILVSSERVARPPAVRGLDYDFYRLSC
PRIERIVRKHLEDVFEKDSGQAPGILRLFFHDCFSQ
GCDASILLNGVDGEDDEKQHDANFALREEALQTIENIRAIVRKQCPRVVSCADILVIAAREAVRQFGGPDIDVPLGRKDSLNFSVNSPDNLPVPFARTDELLTVFGSKKFDATDVVALSG
AHTFGQAHCPTMFNRVIDSDPPIEPNFKKQLEATCPNEESLNAVNLDVRTPNTFDNMYYINLLNHQGVFTSDQDLASHPKTKEIVNLFASNQKEFFNKFANAFVKVSQLDVLTGNQGEIR
KSCFAPNNRKSKVATVVEEVVEIVANM*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, introns 1 and 2) and 5 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATGGTTAGTGCAAGTAGATCTCTTTTTATTTCTTTTCTATTAGCTTCTCTAATCCTTGTTTCCTCTGAGAGAGTAGCAAGGCCTCCTGCTGTGAGGGGACTTGACTATGATTTC
TATCGGTTGTCATGTCCTAGGATTGAAAGGATTGTAAGGAAACATCTTGAAGATGTTTTTGAAAAGGATAGTGGTCAAGCTCCTGGCATACTCAGACTCTTTTTCCATGATTGCTTTTCT
CAG
GTATGATTTAAGATTGTTCTCAAAACCTTACTTTCTTTTTATCGACGTGTCTATTATGAACCTCTAAAAAATGATTCAATAGTTGATCCACCGTTATATCAAGTCCAAGTTAGACAG
ATCCCATTTTATTAAATGGTTTCGAAAATCGTATAACAAAAGAATGGAGGAGAGCAAAAGTATTAATGTGGATTTATATTTTTTTTTAAGAAGCTTAAGTAGAATTAAATTTAACAAAAC
AATCCAACCATATAGAAGTGCTAAGATTGAAAGGATACATAAGTTAATAAACAAAAGGCGCCAAAACATATCGGTGATATCAACCCAACAACACATCAGAAAAACAATATCCAAGAGTAG
TCACAACATATTTCACAAGTGGTAAAAAAATGACAAAAACTCGATTTTTGAATTGAGAATTAAGTTAATTTTGAAGAAAATCCAAAACTCAGTTAAGCCTATTAATAAACAAGGAAAAAC
GATAATCTTTTATAAACAAGAATAATAAAAATTTGCCTTTAACTTTTTTTACCTTCAGAGTTCACACTTCACACTATGTACCCATTTATTTCCATGCATATTTTTCTGTGTGTGGAATTG
TTTCACATGAGATTTAAATTTTATAATTGAGCTGACATCTCGAGGTCAAATATCCTACATAGTTTTTTTTATTTCTATGTAATTGAAAATATTAAATGTTGATTTGTGCCATTAAAAAAA
AAATTAAATGTTGATTTTTGGAGTGAAACAGGGGGATGCGATGCGTCTATTTTGTTGAATGGTGTTGATGGAGAAGATGACGAAAAACAACATGATGCCAACTTCGCTTTAAGGGAGGAG
GCTCTTCAAACCATTGAAAACATTCGTGCTATAGTCCGTAAGCAGTGTCCACGGGTTGTCTCGTGCGCAGATATCCTCGTCATTGCTGCACGCGAAGCTGTTCGCCAA
GTAATTTCTATT
TATTTGTTCACTCTCTTTTGTTTCTTTTTTCGGTTTATTTAAAATAATATAGATCTCATAATATGACAATTATAATTGGTTGAAACTATAAAAACTATTTTTTTGATAGTGGATACAAAT
TAATTCTTCTTTGAATTGCTTCCCTTGAATTTGTACAGTTTTTGGAGGCCCAGATATTGACGTGCCATTGGGAAGAAAAGACAGCCTAAACTTCAGTGTAAACTCACCAGATAATCTCCC
GGTACCATTTGCACGAACAGATGAACTATTAACCGTTTTCGGATCAAAAAAATTCGATGCAACCGATGTAGTTGCTCTATCCGGTGCTCACACTTTCGGTCAAGCTCATTGTCCTACAAT
GTTCAACCGAGTCATTGATTCCGACCCACCAATCGAACCAAATTTCAAGAAACAACTTGAAGCAACATGTCCGAATGAGGAATCCCTCAACGCCGTTAATTTGGATGTTCGAACACCAAA
CACATTCGATAATATGTACTACATTAACCTCTTGAATCACCAGGGTGTATTTACATCTGATCAAGATTTGGCAAGTCATCCTAAGACTAAGGAGATTGTTAACCTCTTTGCTTCAAACCA
GAAAGAGTTTTTTAACAAATTTGCTAATGCTTTTGTTAAGGTAAGTCAATTGGATGTTTTGACCGGAAATCAAGGAGAAATTCGTAAGTCATGTTTTGCTCCAAATAATAGGAAATCTAA
GGTGGCAACTGTGGTGGAAGAGGTCGTGGAAATTGTAGCAAACATGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATGGTTAGTGCAAGTAGATCTCTTTTTATTTCTTTTCTATTAGCTTCTCTAATCCTTGTTTCCTCTGAGAGAGTAGCAAGGCCTCCTGCTGTGAGGGGACTTGACTATGATTTC
TATCGGTTGTCATGTCCTAGGATTGAAAGGATTGTAAGGAAACATCTTGAAGATGTTTTTGAAAAGGATAGTGGTCAAGCTCCTGGCATACTCAGACTCTTTTTCCATGATTGCTTTTCT
CAG
GGATGCGATGCGTCTATTTTGTTGAATGGTGTTGATGGAGAAGATGACGAAAAACAACATGATGCCAACTTCGCTTTAAGGGAGGAGGCTCTTCAAACCATTGAAAACATTCGTGCT
ATAGTCCGTAAGCAGTGTCCACGGGTTGTCTCGTGCGCAGATATCCTCGTCATTGCTGCACGCGAAGCTGTTCGCCAA
TTTGGAGGCCCAGATATTGACGTGCCATTGGGAAGAAAAGAC
AGCCTAAACTTCAGTGTAAACTCACCAGATAATCTCCCGGTACCATTTGCACGAACAGATGAACTATTAACCGTTTTCGGATCAAAAAAATTCGATGCAACCGATGTAGTTGCTCTATCC
GGTGCTCACACTTTCGGTCAAGCTCATTGTCCTACAATGTTCAACCGAGTCATTGATTCCGACCCACCAATCGAACCAAATTTCAAGAAACAACTTGAAGCAACATGTCCGAATGAGGAA
TCCCTCAACGCCGTTAATTTGGATGTTCGAACACCAAACACATTCGATAATATGTACTACATTAACCTCTTGAATCACCAGGGTGTATTTACATCTGATCAAGATTTGGCAAGTCATCCT
AAGACTAAGGAGATTGTTAACCTCTTTGCTTCAAACCAGAAAGAGTTTTTTAACAAATTTGCTAATGCTTTTGTTAAGGTAAGTCAATTGGATGTTTTGACCGGAAATCAAGGAGAAATT
CGTAAGTCATGTTTTGCTCCAAATAATAGGAAATCTAAGGTGGCAACTGTGGTGGAAGAGGTCGTGGAAATTGTAGCAAACATGTAG

Retrieve as FASTA