Entry information : PtPrxQ02 (POPTR_0018s07400 / Potri.018G063300)
Entry ID 4030
Creation 2006-10-30 (Nicolas Rouhier)
Last sequence changes 2006-10-30 (Nicolas Rouhier)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrxQ02 (POPTR_0018s07400 / Potri.018G063300)
Name (synonym) PtPrxQ02 (POPTR_0018s07400 / Potri.018G063300)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation Chloroplastic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrxQ02
start..stop
S start..stop
PbPrxQ01 373 6.66e-134 1..214 1..214
PtPrxQ01 369 2.22e-132 1..214 1..213
AdePrxQ 345 1.22e-122 1..210 3..210
VvPrxQ 337 2.83e-119 1..214 1..217
Gene structure Fichier Exons


exon

Literature and cross-references PtPrxQ02 (POPTR_0018s07400 / Potri.018G063300)
Literature JGI
Gama et physiologia plantarum in press.
DNA ref. Phytozome 12:   Chr18 (7887319..7885851)
Cluster/Prediction ref. UniGene:   Pth.13475  Pth.1563
Omic ref. ePlant:   Potri.018G063300
Protein sequence: PtPrxQ02 (POPTR_0018s07400 / Potri.018G063300)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   214
PWM (Da):   %s   23425.17  
PI (pH):   %s   10.12
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVSISLPNHSLPSLLPTHKPKNLSSQNLPILSKSSRSQFYGLKFSHSSSLSIPSSSSSVKTTIFAKVNKGEVPPSFTLKDQDGKTVSLSKFKGKPVVVYFYPADESPSCTKQACAFRDSY
EKFKKAGAEVVGISGDDPSSHK
AFAKNNRLPFTLLSDEGNKIRKEWGVPADLFGALPGRQTYVLDKNGMVQLIYNNQFQPEKHIDETLKLLQSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 21 ESTs.
DNA
Send to BLAST
CDS
Send to BLAST