Entry information : Pt2CysPrx02 (POPTR_0006s22130 / Pt2CysPrxB / Potri.006G204900)
Entry ID 4032
Creation 2006-11-03 (Nicolas Rouhier)
Last sequence changes 2010-07-08 (Marie Brette (Scipio))
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: Pt2CysPrx02 (POPTR_0006s22130 / Pt2CysPrxB / Potri.006G204900)
Name (synonym) Pt2CysPrx02 (POPTR_0006s22130 / Pt2CysPrxB / Potri.006G204900)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation Chloroplastic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pt2CysPrx02
start..stop
S start..stop
Pt2CysPrx01 482 3.36e-175 1..263 1..269
Ptrem2CysPrx01 446 1.03e-161 38..263 1..226
Vv2CysPrx01 434 2.38e-156 1..263 1..273
Nt2CysPrx02-1A 425 1.04e-152 1..263 1..267
Gene structure Fichier Exons


exon

Literature and cross-references Pt2CysPrx02 (POPTR_0006s22130 / Pt2CysPrxB / Potri.006G204900)
Literature Gama et physiologia plantarum in press.
DNA ref. Phytozome 12:   Chr06 (22075740..22072772)
Omic ref. ePlant:   Potri.006G204900
Protein sequence: Pt2CysPrx02 (POPTR_0006s22130 / Pt2CysPrxB / Potri.006G204900)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   263
PWM (Da):   %s   28677.81  
PI (pH):   %s   8.04
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSATSTSFISSIAAAKSMATPLSKTLTLPNSFSGTRKSIQSPVLRSISLTRGSHSAKSFVVKASSELPLVGNVAPDFEAEAVFDQEFIKVKLSEYIGKKYVVLFFYPLDFTFVCPTEI
TAFSDRYEEFKQINTEVLGVSVDS
FSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSYGVLIPDQGVALRGLFIIDKEGVIQHSTINNLAIGRSVDETKRTLQALQYVQENPDEVCPAG
WKPGDKSMKPDPRQSKDYFAAL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns) and 7 ESTs (DT495540, DT479533, DT484010, DT480697, DT478918, DT497101, DT490852). Found mixed in the Unigen Pth.15098 (Pt2CysPrxA).
DNA
Send to BLAST
CDS
Send to BLAST