Entry information : MtPrx21 (Medtr2g008160.1[4.0] / Medtr2g008160.1[3.5] / Medtr2g008310.1[3.0])
Entry ID 404
Creation 2006-08-16 (Christophe Dunand)
Last sequence changes 2010-09-16 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-07-29 (Christophe Dunand)
Peroxidase information: MtPrx21 (Medtr2g008160.1[4.0] / Medtr2g008160.1[3.5] / Medtr2g008310.1[3.0])
Name (synonym) MtPrx21 (Medtr2g008160.1[4.0] / Medtr2g008160.1[3.5] / Medtr2g008310.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Immature seeds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx21
start..stop
S start..stop
GmPrx03 491 5.76e-177 1..323 1..323
GmPrx172 482 3.01e-173 1..323 1..324
LjPrx72 459 1.08e-164 4..305 1..304
VvPrx12 454 3.02e-162 1..323 5..328
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '404' 'join(1324905..1325111,1325196..1325378,1325487..1325649,1326923..1327341)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1324905..1325111 205 N° 2 1325196..1325378 181 N° 3 1325487..1325649 161 N° 4 1326923..1327341 417
join(1324905..1325111,1325196..1325378,1325487..1325649,1326923..1327341)


exon

Literature and cross-references MtPrx21 (Medtr2g008160.1[4.0] / Medtr2g008160.1[3.5] / Medtr2g008310.1[3.0])
Literature Grusak,M.A. et al., unpublished
DNA ref. Phytozome 12:   chr2 (1324905..1327341)
Cluster/Prediction ref. Phytozome Gene 12:   31068493 UniGene:   Mtr.14497
Omic ref. Gene atlas:   Mtr.38116.1.S1_s_at Legoo:   MTGI7-TC78886  Mtr.38116.1.S1_s_at
Protein sequence: MtPrx21 (Medtr2g008160.1[4.0] / Medtr2g008160.1[3.5] / Medtr2g008310.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (301)
PWM (Da):   %s   35404.06 (32858.7)  
PI (pH):   %s   7.06 (6.77) Peptide Signal:   %s   cut: 23 range:23-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARFVFLSLLFLFLFLIDGSKSQLHVGFYSNTCPQVESTVHDVVR
EAVLFDRTKAAVLLRLHFHDCFVE
GCDGSILINTTQNPEKTAFPHAGVKGFEVIERAKAQLEASCPGVVSCADIVALAARDAIVMANGPAYQVPTGRRDGFVSDKSLAGNMPDVNDSIQQLKTKFLNKGLTEKDLVLLSAAHTI
GTTACFFMRKRLYEFFPFGSDPTINLNFLPELKARCPKDGDVNIRLAMDEGSDLKFDKSILKNIREGFAVLASDARLNDDFVTKSVIDSYFNPINPTFGPSFENDFVQSMVKMGQIGVKT
GSVGNIRRVCSAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 3 introns) and 13 ESTs. Two other splicing variant but very partial. TC78887 and TC78886 are separately compile in TIGR database but corresponded to the same peroxidase.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGGTTTGTTTTTTTGTCTCTCTTATTCTTATTCTTATTCTTAATTGATGGTTCTAAGAGTCAGCTTCATGTTGGTTTCTACTCCAACACATGTCCTCAAGTAGAGTCCACTGTC
CATGATGTTGTTAGAGAAGCTGTTCTTTTTGACAGAACCAAGGCTGCTGTTCTTCTCAGGCTTCATTTTCATGACTGCTTTGTTGAG
AGGTCTTTCTATCTATATATATGTCTCGTGTTT
TAATATGTTTTGGTTCTAACATTTTGTGACATGATTTTGATGGAGTTTTTCAGGGATGTGATGGTTCAATACTGATTAATACTACTCAAAATCCAGAGAAGACTGCATTTCCACATGCAG
GTGTTAAAGGATTTGAAGTGATAGAAAGAGCCAAGGCACAATTAGAAGCATCCTGTCCAGGAGTGGTTTCTTGTGCAGATATTGTTGCATTGGCAGCTAGAGATGCAATTGTCATG
TGGT
CCTAATTCCTAACTTACTCTATTATATTTCATTCTCTAGTATTGTCCACAAAGCTTTTTTTCTTCTTCAAGAAGTTTAATGCTTCTCCATTAACTGTTACATGTAGGCAAATGGACCTGC
ATATCAAGTTCCAACAGGGAGGAGAGATGGATTTGTTTCAGATAAATCTCTTGCAGGTAATATGCCGGATGTTAATGATTCAATTCAGCAACTCAAGACCAAGTTCCTAAACAAGGGTCT
CACAGAAAAAGACCTTGTTCTTCTCAGTG
TGGTACACTCTCTATCTCTCTCTTACACTATAAAACACAGACACAACATGATCCACGTCGATACTGATAATAATTTTAAAAAATGAATTAA
ACAAACATAATCCTATATGTCGATGTCAGACACGTAACATGTGTCAGACACTAAACACGCCTTCAATTAGAAATGTCTGTTTCAGTGCTTCAAGACAACACATGCATATTACATGCAGAG
TAAATGAGATCATGGTTGTTGAAGTGGCAAAGTAATATGAACTAGAACAGGGGAAAAACAAAATAAATAATCACAACAAGACATTGGCCATACCAACTACATGATTTACTCAATTTGGGA
AATTGATAGAGAAGGGTTACTGTATATTAATTAAATATTATGATATAGGATTATAATATTCCAACCAATCACTTTTTTAAGATTTTGTCAATTTTTCAGGATTCTAAGAAATGTTGACAC
AATATCTACCACTCTTTGTTTAATGAGCCTGTTACTGGCCCAATTAAATAAAACAAAAAGATCTCGGATCTCTAGGATTATGTTTTCGCACCTTCTTTTTCCGTCCTATTGAGTTTCTCG
CGCGTTTTTTGTAATTTGGATTATAAAATTAGAACGGCATAAACACTCTATAAAATTCTTCCCATTTTATCATAACATTCTTTCTTCTTTGAACAAGTTTATCATCACATTCTTATTACT
AGAGGATAACCTTTTTTCTGGATTTAAAACCAACTTTCCTTTTGCACCATTTTAGAATTTTGTTCTCTTCTCAAACATATGTCATCATTGTGTATCCTAAAGATAGCAAAGTGTATAGTT
TTTAAACTCTCGTAAAATAACTAAAACATGTAGTTGATATGAGTGTTAAGAGATTCATAAATTTTTAAATAAGTGGTCAGAGATTCAATCTATAACTTTAATGTATGAAAAAAAATTGAT
TGGAATGTGCGGATTTATCTTGTACTTCCTACAAGTATTTTTGTGAAGAGTTAAAAGATAGTGAATATTTTATATCAATAACATGATTAAAAAAACAATTCTATACTATTTGCATTTGTG
CGTTTCTCATATTCATCCAATCACATATTATTTTAGAAAGGTCATGATAGTGAGATATATGATTGATTGTACGTGTACATTTTTTTTTTAACATTATACAACAATGTATATCAATTAAAT
TCTTGTACGGAAAAAAATGTATATCAATTAAATCTTATTATATGTATATTGTTAATTTCTAACCATAGTAATTGTTCACTGATCTGCCATAAACAAAAATTCAGCTGCACATACAATTGG
AACCACAGCATGCTTCTTTATGAGAAAAAGACTATACGAATTTTTCCCATTTGGATCAGACCCAACTATTAACCTGAATTTTCTCCCAGAACTGAAAGCAAGGTGCCCTAAGGATGGAGA
TGTCAACATCCGTTTAGCCATGGATGAAGGGAGTGATCTGAAATTTGACAAGAGTATATTGAAAAACATAAGGGAAGGTTTTGCTGTGTTAGCTTCTGATGCAAGACTTAATGATGACTT
TGTAACAAAGAGTGTCATTGATTCCTACTTCAATCCTATAAATCCAACATTTGGACCTTCTTTTGAAAATGATTTTGTTCAGTCCATGGTAAAAATGGGACAAATTGGAGTAAAGACAGG
TTCTGTTGGAAACATTAGGCGTGTGTGCTCAGCATTTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGGTTTGTTTTTTTGTCTCTCTTATTCTTATTCTTATTCTTAATTGATGGTTCTAAGAGTCAGCTTCATGTTGGTTTCTACTCCAACACATGTCCTCAAGTAGAGTCCACTGTC
CATGATGTTGTTAGAGAAGCTGTTCTTTTTGACAGAACCAAGGCTGCTGTTCTTCTCAGGCTTCATTTTCATGACTGCTTTGTTGAG
GGATGTGATGGTTCAATACTGATTAATACTACT
CAAAATCCAGAGAAGACTGCATTTCCACATGCAGGTGTTAAAGGATTTGAAGTGATAGAAAGAGCCAAGGCACAATTAGAAGCATCCTGTCCAGGAGTGGTTTCTTGTGCAGATATTGTT
GCATTGGCAGCTAGAGATGCAATTGTCATG
GCAAATGGACCTGCATATCAAGTTCCAACAGGGAGGAGAGATGGATTTGTTTCAGATAAATCTCTTGCAGGTAATATGCCGGATGTTAAT
GATTCAATTCAGCAACTCAAGACCAAGTTCCTAAACAAGGGTCTCACAGAAAAAGACCTTGTTCTTCTCAGTG
CTGCACATACAATTGGAACCACAGCATGCTTCTTTATGAGAAAAAGA
CTATACGAATTTTTCCCATTTGGATCAGACCCAACTATTAACCTGAATTTTCTCCCAGAACTGAAAGCAAGGTGCCCTAAGGATGGAGATGTCAACATCCGTTTAGCCATGGATGAAGGG
AGTGATCTGAAATTTGACAAGAGTATATTGAAAAACATAAGGGAAGGTTTTGCTGTGTTAGCTTCTGATGCAAGACTTAATGATGACTTTGTAACAAAGAGTGTCATTGATTCCTACTTC
AATCCTATAAATCCAACATTTGGACCTTCTTTTGAAAATGATTTTGTTCAGTCCATGGTAAAAATGGGACAAATTGGAGTAAAGACAGGTTCTGTTGGAAACATTAGGCGTGTGTGCTCA
GCATTTAATTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGAGATGTAC CATATTGTAT TGTTGTACTT GTAATTAGTG ATGGCTCGGT TTGTTTTTTT GTCTCTCTTA TTCTTATTCT TATTCTTAAT TGATGGTTCT AAGAGTCAGC TTCATGTTGG  TTTCTACTCC AACACATGTC CTCAAGTAGA GTCCACTGTC CATGATGTTG TTAGAGAAGC TGTTCTTTTT GACAGAACCA AGGCTGCTGT TCTTCTCAGG CTTCATTTTC ATGACTGCTT  TGTTGAGGGA TGTGATGGTT CAATACTGAT TAATACTACT CAAAATCCAG AGAAGACTGC ATTTCCACAT GCAGGTGTTA AAGGATTTGA AGTGATAGAA AGAGCCAAGG CACAATTAGA  AGCATCCTGT CCAGGAGTGG TTTCTTGTGC AGATATTGTT GCATTGGCAG CTAGAGATGC AATTGTCATG GCAAATGGAC CTGCATATCA AGTTCCAACA GGGAGGAGAG ATGGATTTGT  TTCAGATAAA TCTCTTGCAG GTAATATGCC GGATGTTAAT GATTCAATTC AGCAACTCAA GACCAAGTTC CTAAACAAGG GTCTCACAGA AAAAGACCTT GTTCTTCTCA GTGCTGCACA  TACAATTGGA ACCACAGCAT GCTTCTTTAT GAGAAAAAGA CTATACGAAT TTTTCCCATT TGGATCAGAC CCAACTATTA ACCTGAATTT TCTCCCAGAA CTGAAAGCAA GGTGCCCTAA  GGATGGAGAT GTCAACATCC GTTTAGCCAT GGATGAAGGG AGTGATCTGA AATTTGACAA GAGTATATTG AAAAACATAA GGGAAGGTTT TGCTGTGTTA GCTTCTGATG CAAGACTTAA  TGATGACTTT GTAACAAAGA GTGTCATTGA TTCCTACTTC AATCCTATAA ATCCAACATT TGGACCTTCT TTTGAAAATG ATTTTGTTCA GTCCATGGTA AAAATGGGAC AAATTGGAGT  AAAGACAGGT TCTGTTGGAA ACATTAGGCG TGTGTGCTCA GCATTTAATT GAAGTCAAAT TGTGATTACA TATATGTAAT TGATGTTCAC ATATTAATTC TGATCTTATT TTTACTGATA 
CATTTCTTGT TTAAATGTCA TGTAATTTAA AAGATTATAC ACAGTATATA AAATATTCTA CC 

Retrieve as FASTA