Entry information : MtPrx78 (Medtr6g027440.1[4.0])
Entry ID 412
Creation 2005-09-14 (Christophe Dunand)
Last sequence changes 2014-07-15 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-07-15 (Christophe Dunand)
Peroxidase information: MtPrx78 (Medtr6g027440.1[4.0])
Name (synonym) MtPrx78 (Medtr6g027440.1[4.0])
Class Class III peroxidase     [Orthogroup: Prx025]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type N/D
Inducers Pathogen interaction
Powdery mildew attack
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx78
start..stop
S start..stop
GmPrx308 374 9e-131 1..317 1..320
GmPrx125 348 1e-120 4..314 3..310
MePrx102 347 3e-120 1..314 1..316
MtPrx89 346 6e-120 14..314 13..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9418573..9418770 198 N° 2 9417231..9417992 762  
complement(join(9417231..9417992,9418573..9418770))


exon

Literature and cross-references MtPrx78 (Medtr6g027440.1[4.0])
Literature Grusak,M.A. et al., unpublished
DNA ref. Phytozome 12:   chr6 (9418770..9417231)
EST ref. GenBank:   CA990423 [3' end]
Cluster/Prediction ref. Phytozome Gene 12:   31104025
Omic ref. Gene atlas:   Mtr.30797.1.S1_at Legoo:   Mtr.30797.1.S1_at
Protein sequence: MtPrx78 (Medtr6g027440.1[4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (300)
PWM (Da):   %s   35656.07 (33418.8) Transmb domain:   %s   o4-26i
PI (pH):   %s   5.78 (5.38) Peptide Signal:   %s   cut: 20 range:20-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLIIILMIFFFVLPFSLAQLRFGFYSFTCPQVEEIVGEVVQSYYQRDITIAGALIRLHYHDCIVNGCDASILIDSRVNRTAEKDAKPNKTLRGFNLIDDIKSNLEQQCPQTVSCADILTIATRDAIALSNGPTYNVLTGRRDGLVSNGFNVTIPGPFSNVSQALNFFTSKGLTLEDMVTLMGAHTIGFAKCIFFQSRLSSFNGNIDPTMDPNLDAFLVEKCGSRGNETSVFLDQKTPFDFDNEFYNQIVNKRGILQIDQQLALDPISNVLVWNFASGNFNFWERFGVSWSKLANLDVKVGNQGEIRRNCRAFNFPLLF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, intron 1) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCATCATAATCTTAATGATCTTCTTCTTTGTCCTTCCTTTCTCATTGGCTCAACTAAGGTTTGGCTTCTATAGTTTTACATGTCCACAAGTAGAGGAAATTGTAGGTGAAGTT
GTGCAAAGTTATTATCAAAGAGATATAACCATTGCTGGTGCCTTGATTCGCTTGCACTATCATGATTGCATTGTCAAT
GTAAGATCCAAAACCTTCTGCTAATTTGTTGTATTTCCGATT
TCTTTATGAATTGACGCTTGTATACTTTTGAGGTCTTTATTGGCACACCTTGTGCTATTAAAGATACTCTGTTGTTCGTAAATCTTATTTTGGTTTGTTCAAAAAAAGATAGAAGATCCA
AAATCTTTTTTTCTTTCTTTCATATTAGTTGTTTTTATTTTACATTCAAATCTTATGCAATATAGATAGTAGATGTAGATCAATTTTGATTTCAAATGTTGATCACTTACTCAAATCAAA
TTTGGTCCAAATATAATGTTGTAAAAGAAATATTTTGACTAACCAAGAAAAAAAAAAAACATTGTGACATGAAATCAATATGTTGGTATCGTTCGATCAAGATCAAATAATTTATATTTG
AGTTTGTTTTTAAGTTTCTTTAAATTTATTTTACCAAACCTAATTAAAATATGGACAATTGTGTGTTTGCATGAATTTTCTGAGCTATTGAAAGGAAGTTCAATCAAAATTAAATTTAGT
ATGCAATATATACAATGGAATTAAAATTGCTCACACATTTTATACTTTTTTATTTTAGGGTTGTGATGCTTCGATACTAATCGATTCAAGAGTAAACAGGACAGCAGAGAAAGATGCAAA
ACCAAACAAAACACTTCGAGGATTCAACCTAATTGACGACATCAAGAGTAACTTAGAACAACAATGCCCCCAAACCGTTTCGTGTGCCGATATCCTAACAATTGCCACAAGAGATGCAAT
TGCATTATCAAATGGACCAACATACAATGTCCTAACAGGAAGAAGAGATGGGTTAGTATCCAATGGCTTCAATGTAACCATTCCTGGACCATTCTCAAATGTGTCACAAGCTCTAAATTT
TTTTACCTCAAAAGGGTTAACATTAGAAGACATGGTAACCCTTATGGGTGCACACACTATTGGTTTTGCTAAATGTATCTTCTTTCAAAGTAGGCTATCAAGTTTTAATGGAAATATTGA
TCCTACAATGGATCCTAATTTAGATGCTTTTTTGGTTGAAAAATGTGGATCAAGAGGGAATGAAACTTCAGTGTTTTTGGATCAAAAAACACCCTTTGATTTTGACAATGAATTTTATAA
TCAAATAGTTAATAAGAGAGGGATACTTCAAATTGATCAACAACTTGCTTTGGATCCTATTTCAAATGTCTTGGTTTGGAATTTTGCAAGTGGTAATTTTAACTTTTGGGAAAGATTTGG
AGTTTCTTGGAGTAAGTTGGCAAATCTTGATGTTAAGGTTGGAAATCAAGGAGAAATTAGAAGAAATTGCAGGGCTTTCAATTTTCCTCTTTTATTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCATCATAATCTTAATGATCTTCTTCTTTGTCCTTCCTTTCTCATTGGCTCAACTAAGGTTTGGCTTCTATAGTTTTACATGTCCACAAGTAGAGGAAATTGTAGGTGAAGTT
GTGCAAAGTTATTATCAAAGAGATATAACCATTGCTGGTGCCTTGATTCGCTTGCACTATCATGATTGCATTGTCAAT
GGTTGTGATGCTTCGATACTAATCGATTCAAGAGTAAACAGG
ACAGCAGAGAAAGATGCAAAACCAAACAAAACACTTCGAGGATTCAACCTAATTGACGACATCAAGAGTAACTTAGAACAACAATGCCCCCAAACCGTTTCGTGTGCCGATATCCTAACA
ATTGCCACAAGAGATGCAATTGCATTATCAAATGGACCAACATACAATGTCCTAACAGGAAGAAGAGATGGGTTAGTATCCAATGGCTTCAATGTAACCATTCCTGGACCATTCTCAAAT
GTGTCACAAGCTCTAAATTTTTTTACCTCAAAAGGGTTAACATTAGAAGACATGGTAACCCTTATGGGTGCACACACTATTGGTTTTGCTAAATGTATCTTCTTTCAAAGTAGGCTATCA
AGTTTTAATGGAAATATTGATCCTACAATGGATCCTAATTTAGATGCTTTTTTGGTTGAAAAATGTGGATCAAGAGGGAATGAAACTTCAGTGTTTTTGGATCAAAAAACACCCTTTGAT
TTTGACAATGAATTTTATAATCAAATAGTTAATAAGAGAGGGATACTTCAAATTGATCAACAACTTGCTTTGGATCCTATTTCAAATGTCTTGGTTTGGAATTTTGCAAGTGGTAATTTT
AACTTTTGGGAAAGATTTGGAGTTTCTTGGAGTAAGTTGGCAAATCTTGATGTTAAGGTTGGAAATCAAGGAGAAATTAGAAGAAATTGCAGGGCTTTCAATTTTCCTCTTTTATTTTAA

Retrieve as FASTA