Entry information : MtPrx84 (Medtr3g094630.1[4.0]Medtr3g094630.1[3.5] / x)
Entry ID 418
Creation 2008-10-03 (Christophe Dunand)
Last sequence changes 2008-10-03 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-07-29 (Messaoudi)
Peroxidase information: MtPrx84 (Medtr3g094630.1[4.0]Medtr3g094630.1[3.5] / x)
Name (synonym) MtPrx84 (Medtr3g094630.1[4.0]Medtr3g094630.1[3.5] / x)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx84
start..stop
S start..stop
MtPrx98 588 0 1..322 1..322
MtPrx54 567 0 1..322 1..322
GmPrx328 548 0 6..322 5..320
GmPrx158 541 0 6..322 5..320
Gene structure Fichier Exons


exon

Literature and cross-references MtPrx84 (Medtr3g094630.1[4.0]Medtr3g094630.1[3.5] / x)
Literature REFERENCE 1 Torres-Jerez,I. et al., unpublished.

REFERENCE 2 Farag,M.A., Deavours,B.E., De-Fatima,A., Naoumkina,M., Dixon,R.A. and Sumner,L.W. Integrated metabolite and transcript profiling identifies a novel phytoalexin and related peroxidases involved in aurone biosynthesis in Medicago truncatula cell cultures.
DNA ref. Phytozome 12:   chr3 (43179421..43180983)
mRNA ref. GenBank:   EF456703
Cluster/Prediction ref. Phytozome Gene 12:   31060595 UniGene:   Mtr.8723
Omic ref. Gene atlas:   Mtr.42141.1.S1_at  Mtr.42141.1.S1_s_at Legoo:   Mtr.42141.1.S1_at  Mtr.42141.1.S1_s_at
Protein sequence: MtPrx84 (Medtr3g094630.1[4.0]Medtr3g094630.1[3.5] / x)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (296)
PWM (Da):   %s   33822.93 (31154.5) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.17 (9.14) Peptide Signal:   %s   cut: 27 range:27-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPLNCSRLTMISLVLSVLIIGSANAQLSTNFYSKTCPKLSTTVK
STLQTAISKEARMGASILRLFFHDCFVN
GCDGSILLDDTSSFTGEKNANPNRNSARGFDVIDNIKTAVENVCPGVVSCADILAIAAADSVAILGGPTWNVKLGRRDAKTASQSAANTAIPAPTSNLNTLTSMFSAVGLSSKDLVTLSG
AHTIGQARCTNFRARIYNETNINAAFASTRQSNCPKASGSGDNNLAPLDLQTPSSFDNNYFKNLVQNKGLLHSDQQLFNGGSTNSIVSGYSTSPSSFSSDFAAAMIKMGNIKPLTGSNGE
IRKNCRKTN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 3 introns) and 5 ESTs. Cultivar="Jemalong A17".
DNA
Send to BLAST
CDS
Send to BLAST