Entry information : PnoHalPrx01 (SNOG_05198)
Entry ID 4187
Creation 2007-01-29 (Filippo Passardi)
Last sequence changes 2007-01-29 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PnoHalPrx01 (SNOG_05198)
Name (synonym) PnoHalPrx01 (SNOG_05198)
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Phaeosphaeriaceae Phaeosphaeria
Organism Phaeosphaeria nodorum (Stagonospora nodorum)    [TaxId: 13684 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PnoHalPrx01
start..stop
S start..stop
AteHalPrx01 354 8e-125 25..264 1..240
AniHalPrx01 349 2e-122 1..264 1..262
GzHalPrx01 333 3e-116 1..266 1..266
TterHalPrx01 209 3e-67 38..249 40..252
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 911896..912025 130 N° 2 912093..912333 241 N° 3 912397..912668 272 N° 4 912732..912861 130
N° 5 912995..913064 70  
join(911896..912025,912093..912333,912397..912668,912732..912861,912995..913064)


exon

Literature and cross-references PnoHalPrx01 (SNOG_05198)
Literature Hane J.K., Lowe R.G.T., Solomon P.S., Tan K.-C., Schoch C.L., Spatafora J.W., Crous P.W., Kodira C.D., Birren B.W., Galagan J.E., Torriani S.F.F., McDonald B.A., Oliver R.P. Dothideomycete-plant interactions illuminated by genome sequencing and EST analysis of the wheat pathogen Stagonospora nodorum. Plant Cell 19:3347-3368(2007)
Protein ref. UniProtKB:   Q0USR6
DNA ref. JGI genome:   scaffold_7 (911896..913064)
Protein sequence: PnoHalPrx01 (SNOG_05198)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   280 (262)
PWM (Da):   %s   31064.47 (29238.5)  
PI (pH):   %s   9.1 (8.69) Peptide Signal:   %s   cut: 19 range:19-280
Sequence 321
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKVSSVLSFSSIFASALAFPTYGNVNARQTWQPRNWTAPGPNDARGPCPGMNTLANHGYLPHNGRKITRDILADAMLSGFNIAKSDAIILFSQAVRTNPEPFARTFDLDTLGREGVLEHDFSLSRSDRFFANPLPFNETVWAETASFFKTPEITIQQLADARMARLETSKRTNPQHKTSALADGFSWGECASFFEIMADGTTGTVRKDFIEYWLRNERMPTEIGWTRRPTVMETSERTKFTRALMDAAGQGTGLSLSSSYRYPIKQVAFAEQLGQSKSAD

Retrieve as FASTA  
Remarks Complete sequence from Genomic (3 introns). Strain="SN15".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGGTCTCATCAGTTCTCAGCTTCTCTTCCATCTTTGCGTCAGCCTTGGCCTTCCCTACCTATGGCAATGTTAACGCCCGCCAAACCTGGCAGCCTAGGAACTGGACGGCTCCAGGCC
CGAATGATG
GTTAGTAGAGATGTCTAGCACATTTTCAGTCGTGATAAGAGCATCCCACTGATCAGTGACTCAATAGCACGTGGACCATGCCCTGGCATGAACACTCTCGCCAACCACGGG
TATTTACCGCATAACGGGCGGAAGATCACACGCGATATCCTCGCCGATGCAATGCTCTCGGGCTTCAACATCGCCAAGAGCGACGCCATTATCCTCTTTTCGCAGGCCGTACGCACCAAC
CCGGAGCCGTTCGCACGTACGTTCGACCTGGACACGTTGGGCCGTGAGGGCGTACTGGAGCATGATTTCAGCCTGAG
GTAAATACATCATTCGTCGATCGCCTAGCATATTTCGCACGCT
GACGTATCGACCACCTACAGTCGATCTGACCGCTTCTTCGCCAACCCTCTCCCATTCAACGAAACCGTCTGGGCAGAGACAGCCTCCTTCTTCAAGACACCAGAGATCACCATACAACAG
CTGGCCGACGCCCGCATGGCACGGCTCGAAACATCGAAGCGCACCAACCCACAGCACAAGACATCGGCGCTGGCTGATGGCTTCAGTTGGGGGGAATGCGCTTCTTTCTTTGAGATAATG
GCTGATGGCACCACGGGCACGGTGAGGAAAGACTTTATTGAGTACTGGTTGC
GTAAGTTTCAAAATCCATTCAGCGGATGGATAGAGACTGGTTGCTGACGCATATCTGCTGTAGGAAAC
GAGCGCATGCCTACTGAGATTGGCTGGACTCGCCGTCCGACTGTCATGGAGACTAGCGAGCGTACCAAGTTCACGCGTGCTTTGATGGATGCTGCTGGCCAGGGTACTGGCCTTTCCTTG
TCTTC
GTGAGCGACTTTGGCAGGTTGTAGCTGTTTCTCACTTGCTGGAAGCTGAAAAAGAAAGGAATGAGTACAGTGTACAAGCTGAATGTGCTCGAAGAATTTCATTGTGTATATATTA
TGGGCTATAGGCGTACAGGTCCTATCGTTATCCAATTAAACAGGTTGCTTTTGCTGAACAGCTCGGCCAGTCAAAGTCTGCCGATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGGTCTCATCAGTTCTCAGCTTCTCTTCCATCTTTGCGTCAGCCTTGGCCTTCCCTACCTATGGCAATGTTAACGCCCGCCAAACCTGGCAGCCTAGGAACTGGACGGCTCCAGGCC
CGAATGATG
CACGTGGACCATGCCCTGGCATGAACACTCTCGCCAACCACGGGTATTTACCGCATAACGGGCGGAAGATCACACGCGATATCCTCGCCGATGCAATGCTCTCGGGCTTCA
ACATCGCCAAGAGCGACGCCATTATCCTCTTTTCGCAGGCCGTACGCACCAACCCGGAGCCGTTCGCACGTACGTTCGACCTGGACACGTTGGGCCGTGAGGGCGTACTGGAGCATGATT
TCAGCCTGAG
TCGATCTGACCGCTTCTTCGCCAACCCTCTCCCATTCAACGAAACCGTCTGGGCAGAGACAGCCTCCTTCTTCAAGACACCAGAGATCACCATACAACAGCTGGCCGACG
CCCGCATGGCACGGCTCGAAACATCGAAGCGCACCAACCCACAGCACAAGACATCGGCGCTGGCTGATGGCTTCAGTTGGGGGGAATGCGCTTCTTTCTTTGAGATAATGGCTGATGGCA
CCACGGGCACGGTGAGGAAAGACTTTATTGAGTACTGGTTGC
GAAACGAGCGCATGCCTACTGAGATTGGCTGGACTCGCCGTCCGACTGTCATGGAGACTAGCGAGCGTACCAAGTTCA
CGCGTGCTTTGATGGATGCTGCTGGCCAGGGTACTGGCCTTTCCTTGTCTTC
GTCCTATCGTTATCCAATTAAACAGGTTGCTTTTGCTGAACAGCTCGGCCAGTCAAAGTCTGCCGATT
GA

Retrieve as FASTA