Entry information : AniHalPrx02
Entry ID 4190
Creation 2007-01-23 (Filippo Passardi)
Last sequence changes 2007-01-23 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: AniHalPrx02
Name AniHalPrx02
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Emericella
Organism Aspergillus nidulans-Emericella nidulans    [TaxId: 162425 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AniHalPrx02
start..stop
S start..stop
AteHalPrx02 353 2.94e-124 1..265 1..262
AorHalPrx02 352 1e-123 3..266 6..257
CgHalPrx01 309 9.94e-107 1..267 1..268
PnoHalPrx03 260 2.08e-87 9..266 20..261
Gene structure Fichier Exons


exon

Literature and cross-references AniHalPrx02
Literature Galagan, J.E. et al.
"Sequencing of Aspergillus nidulans and comparative analysis with A. fumigatus and A. oryzae."
Nature 438:1105-1115(2005)
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=29571006&itemID=14&view=gbwithparts
Protein ref. GenPept:   40747861 UniProtKB:   Q5ATI5
DNA ref. JGI genome:   ChrV_A_nidulans_FGSC_A4 (350832..349840)
Protein sequence: AniHalPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   268 (517)
PWM (Da):   %s   29403.74 (56847.2)  
PI (pH):   %s   6.68 (9.96) Peptide Signal:   %s   cut: 18 range:18-534
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKVATPLMAILGLSAANPHYGAGDISQWTGPGAGDYRGPCPMMNTLANHNFLPHDGRNITRDKLIRALGEALNFHPSLASLMFDMAIVVNPEPNATWFTLDQLNQHNILEHDASLSRTDAFFGNNHIFNASIFAETTHYWTNTTLTPLMLANSKL
ARQITSRAFNPTYTFTNSTEQFSLGEVAAPVVAFGNLNDGTVEKELVEYFFRNERFPTHLGWKTRDQVVQLADITKLSRIIGGMTDLLTSTGDAATASPARVKRADLHAGFRG

Retrieve as FASTA  
Remarks Complete sequence from Genomic. 5 exons. Strain="FGSC4".
DNA
Send to BLAST
CDS
Send to BLAST