Entry information : PnoHalPrx03
Entry ID 4196
Creation 2007-01-29 (Filippo Passardi)
Last sequence changes 2007-01-29 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PnoHalPrx03
Name PnoHalPrx03
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Phaeosphaeriaceae Phaeosphaeria
Organism Phaeosphaeria nodorum (Stagonospora nodorum)    [TaxId: 13684 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PnoHalPrx03
start..stop
S start..stop
AorHalPrx02 301 1e-103 15..261 5..257
AteHalPrx02 290 3e-99 26..260 17..262
CgHalPrx01 279 6e-95 1..267 1..269
SsclHalPrx01 265 2e-89 31..260 33..270
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28336..28453 118 N° 2 28499..29011 513 N° 3 29087..29265 179  
join(28336..28453,28499..29011,29087..29265)


exon

Literature and cross-references PnoHalPrx03
Literature Birren et al.

Annotation of the Phaeosphaeria nodorum SN15 genome

Unpublished
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=62361720&itemID=11&view=gbwithparts
Protein ref. GenPept:   111055427 UniProtKB:   Q0TWP8
DNA ref. JGI genome:   scaffold_42 (28336..29265)
Protein sequence: PnoHalPrx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   269 (249)
PWM (Da):   %s   29565.62 (27383.6)  
PI (pH):   %s   5.51 (5.52) Peptide Signal:   %s   cut: 21 range:21-269
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSATNLFVFFACIVIDTHARLQYETTNPHEWIASGPNDLRGPCPMLNTLANHGFLPHDGRNITKANAIAGLNGGLNFNGSLGALMWEQAIFANPEPNATFFTLEHLNVHNVLEHDARMTRTDAYFGNNHVFNETVYNASRQWWTDETVTAEQLAHSKLFRQIESRASNPYYKFTASTEEFSLGEVAAPIIAFGDMGAGTVDRALMEYFFELGWSKKAVEVALADILSVTDMIRNATSLITGTPVEKVGNLNGGRDLHAGFVAQISRLS

Retrieve as FASTA  
Remarks Complete sequence from Genomic. Strain="SN15". 3 exons.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATCGGCCACGAACCTGTTTGTCTTCTTTGCCTGTATAGTCATTGACACACATGCCAGACTGCAATACGAAACCACCAACCCTCACGAATGGATAGCGTCCGGACCGAATGATCGT
GAGTCGAACCAAAATCTCTCTTCTTGATCTAATCATGTCGTAGTCCGAGGACCTTGTCCGATGCTCAACACCTTAGCCAACCATGGATTCCTTCCTCACGACGGTCGTAACATCACAAAA
GCCAATGCCATTGCCGGTCTTAATGGTGGTCTGAACTTCAACGGGTCACTTGGGGCACTCATGTGGGAGCAAGCCATTTTTGCCAATCCCGAGCCCAATGCCACCTTCTTCACACTCGAG
CATCTCAATGTGCACAATGTGCTGGAACACGATGCTAGAATGACTCGGACGGATGCGTACTTTGGCAATAACCACGTCTTCAACGAGACGGTGTACAACGCGTCGAGACAATGGTGGACG
GATGAGACGGTGACGGCGGAGCAGCTGGCGCACAGTAAGCTCTTCCGCCAGATTGAGAGCCGCGCATCGAATCCATACTATAAATTTACCGCGTCGACGGAAGAGTTTAGCCTGGGCGAG
GTGGCTGCACCGATAATTGCGTTTGGCGATATGGGTGCCGGTACGGTTGACCGTGCATTAATGGAGTACTTCTTTG
GTAAGCAAGCTTGTTGCCATCGCATTCCTTTGGGCGTGAGTTGA
TGGCCCCTAGAGAACGAACGCCTTCCGATAGAACTGGGATGGTCGAAGAAGGCGGTTGAAGTTGCGCTTGCGGACATTCTGAGTGTCACGGACATGATTCGAAATGCAACGAGCCTCATC
ACCGGCACGCCAGTAGAGAAAGTTGGAAACCTGAATGGAGGCCGCGATCTGCATGCCGGGTTTGTGGCGCAAATTTCACGCTTGTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATCGGCCACGAACCTGTTTGTCTTCTTTGCCTGTATAGTCATTGACACACATGCCAGACTGCAATACGAAACCACCAACCCTCACGAATGGATAGCGTCCGGACCGAATGATCTC
CGAGGACCTTGTCCGATGCTCAACACCTTAGCCAACCATGGATTCCTTCCTCACGACGGTCGTAACATCACAAAAGCCAATGCCATTGCCGGTCTTAATGGTGGTCTGAACTTCAACGGG
TCACTTGGGGCACTCATGTGGGAGCAAGCCATTTTTGCCAATCCCGAGCCCAATGCCACCTTCTTCACACTCGAGCATCTCAATGTGCACAATGTGCTGGAACACGATGCTAGAATGACT
CGGACGGATGCGTACTTTGGCAATAACCACGTCTTCAACGAGACGGTGTACAACGCGTCGAGACAATGGTGGACGGATGAGACGGTGACGGCGGAGCAGCTGGCGCACAGTAAGCTCTTC
CGCCAGATTGAGAGCCGCGCATCGAATCCATACTATAAATTTACCGCGTCGACGGAAGAGTTTAGCCTGGGCGAGGTGGCTGCACCGATAATTGCGTTTGGCGATATGGGTGCCGGTACG
GTTGACCGTGCATTAATGGAGTACTTCTTTG
AACTGGGATGGTCGAAGAAGGCGGTTGAAGTTGCGCTTGCGGACATTCTGAGTGTCACGGACATGATTCGAAATGCAACGAGCCTCATC
ACCGGCACGCCAGTAGAGAAAGTTGGAAACCTGAATGGAGGCCGCGATCTGCATGCCGGGTTTGTGGCGCAAATTTCACGCTTGTCTTAA

Retrieve as FASTA