Entry information : AniHalPrx05
Entry ID 4206
Creation 2007-01-23 (Filippo Passardi)
Last sequence changes 2007-01-23 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: AniHalPrx05
Name AniHalPrx05
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Emericella
Organism Aspergillus nidulans-Emericella nidulans    [TaxId: 162425 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AniHalPrx05
start..stop
S start..stop
CgHalPrx04 181 1.07e-57 1..159 1..156
PangHalPrx04 105 2.33e-28 23..166 36..175
NcHalPrx01 105 2.53e-28 24..142 42..161
AniHalPrx01 104 4.24e-28 27..182 33..183
Gene structure Fichier Exons


exon

Literature and cross-references AniHalPrx05
Literature Galagan JE et al. Sequencing of Aspergillus nidulans and comparative analysis with A. fumigatus and A. oryzae. Nature 438 (7071), 1105-1115 (2005)
Protein ref. UniProtKB:   Q5AUV6
DNA ref. JGI genome:   ChrII_A_nidulans_FGSC_A4 (244426..245099)
Protein sequence: AniHalPrx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   183 (166)
PWM (Da):   %s   20284.12 (18395.0)  
PI (pH):   %s   8.01 (8.01) Peptide Signal:   %s   cut: 18 range:18-183
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLIFVLETLLFSLAVASCPYGHDNHKWQRPRPEDSRSPCPGLNAMANHGYLPRNGKNIDLAVARAAISGAFNYEPTTIDFMFQAAIDFNLSTTGNRSTIHLADLRKHDTIEFDGSLSRSDLYFGDNLHFNPSIWATVAEHLNLYDTGPCGNETY
VTTRQGRCRRAGLGHSLVRIFLRANGLR

Retrieve as FASTA  
Remarks Complete sequence from Genomic (Chromo 2, 1 introns). Strain="FGSC 4". Very short 3'end: verified manually and with Softberry, but no HalPrx-homologous region up to 5'000bp downstream. Still functional?
DNA
Send to BLAST
CDS
Send to BLAST