Entry information : PnoHalPrx05
Entry ID 4208
Creation 2010-04-24 (Christophe Dunand)
Last sequence changes 2014-11-26 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-05 (Achraf Jemmat)
Peroxidase information: PnoHalPrx05
Name PnoHalPrx05
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Phaeosphaeriaceae Phaeosphaeria
Organism Phaeosphaeria nodorum (Stagonospora nodorum)    [TaxId: 13684 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PnoHalPrx05
start..stop
S start..stop
PnoHalPrx04 183 7e-57 30..277 6..251
AniHalPrx04 172 5e-52 44..265 29..250
PanHalPrx03 167 8e-51 44..263 22..242
AniHalPrx04_FGSC26 162 3e-48 44..237 29..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 692984..693173 190 N° 2 693224..693868 645 N° 3 693907..694000 94  
join(692984..693173,693224..693868,693907..694000)


exon

Literature and cross-references PnoHalPrx05
Literature Birren B. et al. Annotation of the Phaeosphaeria nodorum SN15 genome
unpublished
Protein ref. UniProtKB:   Q0UER2 [Incorrect prediction]
DNA ref. JGI genome:   scaffold_15 (692984..694000)
EST ref. GenBank:   EH400627.1 [5' end]   EH396702.1 [3' end]
Protein sequence: PnoHalPrx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   308 (291)
PWM (Da):   %s   32741.67 (31080.8)  
PI (pH):   %s   5.3 (5.09) Peptide Signal:   %s   cut: 18 range:18-308
Sequence 349
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRFSLASVLLGASAVSAQSLLGLPLDIATLLSSLKPAADNDPRFTDFHPPGTGDVRSPCPALNTLANHGFIHHDGKKMTIPHLIKGLAEGMNIGADFTTAIGAAGLLSSPFPLGGSFDLDDLNMHNFPIEHDASISRQDAALGNPQPFYNPNWQQYISFFSGKTLTDIPTAAQAKFARYQDSVSKNKEFVYGIREAVLSYGENALYLQGMADPISGKAKVEYVRTFFEQEKLPYAQGWRPSPAPITLASLGIMIGELSASSPEPFAEGVRVLDGFVLTDSYKDVLIATVGGSKILANLTEGISSALGL

Retrieve as FASTA  
Remarks Complete sequence from Genomic (3 introns) and 4 ESTs (EH396465, EH400627 and EH396702). Strain="SN15". Incorrect prediction from Swiss-Prot accession. The missing sequence is confirmed by the EST sequence.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCGTTTCTCTCTCGCTTCTGTGCTGCTAGGCGCGAGTGCAGTCTCAGCTCAATCGCTGCTGGGACTGCCGCTGGATATAGCTACGCTACTGTCAAGCTTGAAGCCCGCTGCGGATAACG
ACCCGCGATTTACGGATTTCCATCCTCCAGGCACTGGCGATGTGCGCTCGCCATGTCCAGCTCTAAACA
GTACTTCACCCATGCCCCCTTCAAAAACCCCATGTCTAACCTCCCCTAGGC
CCTTGCTAACCACGGTTTCATCCACTNNCACGACGGCAAGAAAATGACCATCCTCANNCATCTCATCAAAGGCCTCGCCGAAGGCATGAACATCGGCGCAGACTTCACGACCGCCATCGG
CGCCGCCGGCCTCCTCTCCTCCCCCTTCCCCCTCGGCGGCTCCTTCGACCTCGACGATTTAAACATGCACAACTTCCCTATAGAGCACGACGCGTCGATATCCCGACAGGACGCCGCGCT
CGGCAATCCCCAGCCCTTCTACAACCCCAACTGGCAGCAGTACATCTCCTTCTTCAGCGGCAAGACGCTAACCGATATACCGACGGCCGCACAGGCCAAGTTCGCGCGGTACCAGGACAG
TGTGAGCAAGAACAAGGAGTTTGTGTATGGGATTCGCGAGGCGGTGTTGAGTTATGGGGAGAACGCGTTGTATTTGCAGGGCATGGCGGATCCGATATCCGGCAAGGCGAAGGTCGAGTA
CGTGAGGACGTTCTTCGAGCAGGAGAAGTTGCCGTATGCGCAGGGATGGAGGCCGAGTCCGGCGCCGATCACGCTGGCGAGTTTGGGAATTATGATTGGGGAGCTGTCTGCTTCGAGCCC
GGAGCCGTTTGCTGAAGGGGTCAGGGTTTTGGACGTAAGTGTGG
TTGTGTTTGCTGTGGTTGCGATTGAAAACTAACAACCAGTAGGGATTCGTATAAGGATGTATTGATAGCCACTGTT
GGTGGATCGAAGATTTTGGCAAACCTTACTGAGGGTATTAGCTCTGCGCTTGGACT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCGTTTCTCTCTCGCTTCTGTGCTGCTAGGCGCGAGTGCAGTCTCAGCTCAATCGCTGCTGGGACTGCCGCTGGATATAGCTACGCTACTGTCAAGCTTGAAGCCCGCTGCGGATAACG
ACCCGCGATTTACGGATTTCCATCCTCCAGGCACTGGCGATGTGCGCTCGCCATGTCCAGCTCTAAACA
CCCTTGCTAACCACGGTTTCATCCACTNNCACGACGGCAAGAAAATGACCA
TCCTCANNCATCTCATCAAAGGCCTCGCCGAAGGCATGAACATCGGCGCAGACTTCACGACCGCCATCGGCGCCGCCGGCCTCCTCTCCTCCCCCTTCCCCCTCGGCGGCTCCTTCGACC
TCGACGATTTAAACATGCACAACTTCCCTATAGAGCACGACGCGTCGATATCCCGACAGGACGCCGCGCTCGGCAATCCCCAGCCCTTCTACAACCCCAACTGGCAGCAGTACATCTCCT
TCTTCAGCGGCAAGACGCTAACCGATATACCGACGGCCGCACAGGCCAAGTTCGCGCGGTACCAGGACAGTGTGAGCAAGAACAAGGAGTTTGTGTATGGGATTCGCGAGGCGGTGTTGA
GTTATGGGGAGAACGCGTTGTATTTGCAGGGCATGGCGGATCCGATATCCGGCAAGGCGAAGGTCGAGTACGTGAGGACGTTCTTCGAGCAGGAGAAGTTGCCGTATGCGCAGGGATGGA
GGCCGAGTCCGGCGCCGATCACGCTGGCGAGTTTGGGAATTATGATTGGGGAGCTGTCTGCTTCGAGCCCGGAGCCGTTTGCTGAAGGGGTCAGGGTTTTGGACGTAAGTGTGG
GTAGGG
ATTCGTATAAGGATGTATTGATAGCCACTGTTGGTGGATCGAAGATTTTGGCAAACCTTACTGAGGGTATTAGCTCTGCGCTTGGACT

Retrieve as FASTA