Entry information : PnoHalPrx07
Entry ID 4220
Creation 2007-01-29 (Filippo Passardi)
Last sequence changes 2007-01-29 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PnoHalPrx07
Name PnoHalPrx07
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Phaeosphaeriaceae Phaeosphaeria
Organism Phaeosphaeria nodorum (Stagonospora nodorum)    [TaxId: 13684 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PnoHalPrx07
start..stop
S start..stop
PcHalPrx01 309 2e-106 4..267 17..279
PcarHalPrx01 303 8e-104 4..266 17..278
PplHalPrx01 301 5e-103 4..267 16..277
PplHalPrx03 300 1e-102 4..267 16..277
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 498944..499578 635 N° 2 498695..498878 184  
complement(join(498695..498878,498944..499578))


exon

Literature and cross-references PnoHalPrx07
Literature Birren B. et al. Annotation of the Phaeosphaeria nodorum SN15 genome. unpublished
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=Nucleotide&list_uids=62183320&dopt=GenBank
Protein ref. GenPept:   111061805 UniProtKB:   Q0UF04
DNA ref. JGI genome:   scaffold_15 (499578..498695)
Protein sequence: PnoHalPrx07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   272
PWM (Da):   %s   29794.14  
PI (pH):   %s   7.2
Sequence 313
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPTLAQKLSKPFVDISVLVWDFNLFLLNLLLPSQPSTDVVPSSAPGAHGHWGTYTPPGPDDSRSACPMLNALANHSILPHSGKNISFRQLNTTVRQSFNFAPSFCFFVPNFAANFLSRSYWTGTFDLAELSKHNAIEHDASLTRRDAAEVSDQGKPDLELVKELLDAATGEGGKRLTKGDLSRILAKRRLECRANNEAYSESLFHNGFGSANSSTMLTIFGGDVDDLRPMLTEERFVEGWQPRILSRFGLTMAAFNGTVLPVELGVKRAKIE

Retrieve as FASTA  
Remarks Complete sequence from Genomic. 2 exons. strain="SN15".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGACCCTAGCACAAAAACTCTCCAAGCCCTTCGTCGACATATCCGTCCTGGTATGGGACTTCAACCTCTTCCTCCTCAACCTGCTTCTCCCCTCCCAACCATCCACAGACGTCGTC
CCTTCCTCTGCCCCCGGCGCCCACGGCCACTGGGGCACCTACACGCCGCCCGGCCCCGACGACTCGCGCTCCGCCTGCCCGATGCTCAATGCGCTCGCCAACCACTCCATCCTCCCGCAC
TCCGGTAAGAACATCTCCTTCCGGCAGCTCAACACCACCGTGCGCCAATCCTTCAACTTCGCCCCGAGCTTCTGCTTCTTCGTGCCCAACTTCGCCGCAAACTTTCTGTCACGCAGCTAT
TGGACGGGCACGTTTGACCTCGCCGAGCTGAGCAAGCATAATGCGATTGAGCATGATGCGAGCTTGACGAGGAGGGATGCGGCGGAGGTCAGCGATCAGGGGAAGCCGGATTTGGAGCTT
GTAAAGGAGTTGTTGGACGCGGCGACGGGGGAGGGCGGGAAGAGGCTCACCAAGGGTGATTTGTCGCGCATTTTGGCGAAGAGGAGATTGGAGTGTAGGGCGAATAATGAGGCGTACAGT
GAGAGTTTGTTTCACAATGGATTCGGGAGCGCGAA
GTAAGTTTTTCCCTATTATGATCATATAATCTGTAATTTGCAAGAATGTGCTAATCTTTACGCAGCTCTTCTACTATGCTGACGA
TATTCGGCGGGGACGTGGATGATCTCAGACCTATGCTTACCGAAGAGCGATTCGTGGAGGGCTGGCAGCCGCGGATTTTGAGCCGCTTTGGCCTTACGATGGCGGCATTCAACGGGACGG
TTTTGCCGGTTGAGCTGGGTGTCAAAAGGGCGAAGATCGAGTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGACCCTAGCACAAAAACTCTCCAAGCCCTTCGTCGACATATCCGTCCTGGTATGGGACTTCAACCTCTTCCTCCTCAACCTGCTTCTCCCCTCCCAACCATCCACAGACGTCGTC
CCTTCCTCTGCCCCCGGCGCCCACGGCCACTGGGGCACCTACACGCCGCCCGGCCCCGACGACTCGCGCTCCGCCTGCCCGATGCTCAATGCGCTCGCCAACCACTCCATCCTCCCGCAC
TCCGGTAAGAACATCTCCTTCCGGCAGCTCAACACCACCGTGCGCCAATCCTTCAACTTCGCCCCGAGCTTCTGCTTCTTCGTGCCCAACTTCGCCGCAAACTTTCTGTCACGCAGCTAT
TGGACGGGCACGTTTGACCTCGCCGAGCTGAGCAAGCATAATGCGATTGAGCATGATGCGAGCTTGACGAGGAGGGATGCGGCGGAGGTCAGCGATCAGGGGAAGCCGGATTTGGAGCTT
GTAAAGGAGTTGTTGGACGCGGCGACGGGGGAGGGCGGGAAGAGGCTCACCAAGGGTGATTTGTCGCGCATTTTGGCGAAGAGGAGATTGGAGTGTAGGGCGAATAATGAGGCGTACAGT
GAGAGTTTGTTTCACAATGGATTCGGGAGCGCGAA
CTCTTCTACTATGCTGACGATATTCGGCGGGGACGTGGATGATCTCAGACCTATGCTTACCGAAGAGCGATTCGTGGAGGGCTGG
CAGCCGCGGATTTTGAGCCGCTTTGGCCTTACGATGGCGGCATTCAACGGGACGGTTTTGCCGGTTGAGCTGGGTGTCAAAAGGGCGAAGATCGAGTA

Retrieve as FASTA