Entry information : PnoHalPrx09
Entry ID 4230
Creation 2007-01-29 (Filippo Passardi)
Last sequence changes 2007-01-29 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PnoHalPrx09
Name PnoHalPrx09
Class Haloperoxidase (haem)    [Orthogroup: HalPrx002]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Phaeosphaeriaceae Phaeosphaeria
Organism Phaeosphaeria nodorum (Stagonospora nodorum)    [TaxId: 13684 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PnoHalPrx09
start..stop
S start..stop
MpiHalPrx01 264 4e-85 1..412 1..411
GzHalPrx04 260 4e-83 65..410 42..416
PnoHalPrx10 256 1e-81 40..408 24..416
AteHalPrx03 223 6e-69 4..392 7..421
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 495588..495897 310 N° 2 495945..496386 442 N° 3 496424..496639 216 N° 4 496688..496967 280
join(495588..495897,495945..496386,496424..496639,496688..496967)


exon

Literature and cross-references PnoHalPrx09
Literature Birren B. et al.

Annotation of the Phaeosphaeria nodorum SN15 genome

unpublished
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=62361747&itemID=214&view=gbwithparts
Protein ref. GenPept:   111061804 UniProtKB:   Q0UF05
DNA ref. JGI genome:   scaffold_15 (495588..496967)
Protein sequence: PnoHalPrx09
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   415 (396)
PWM (Da):   %s   43661.79 (41756.8)  
PI (pH):   %s   4.71 (4.63) Peptide Signal:   %s   cut: 20 range:20-415
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHFSSIPLSLAALAPLANAFPAAIMEAAAADPELLARASEMAAQLKGRQAGADAASALFEPIPIFNEKAQFINVTKGSGHEYVAPGPNDLRGPCPGLNAFANHNFLPHNGYASVAQYIEATTKVVGMGANLALFLSVLGGALDGDVLNWSMGGTPSLAQGGVTGILGNGLTGSHNKYEGDASPTRPDLYQAGNNYKCVTEQFQDLINHSPGGVVTLDSLTSFRSDRFDAQKKSNPYFFNGPFSGVLVQPAAAENPIGELSYETIQSWFGVEGTNGNYKAVQGTERIPDNWYRRAIEYPYETTYFVGDALNAIALHPKFLDIGGNTGTPDSFTGVDIGDLTGGVFNAETLTQGNNFGCFLYQVAAQAKPDILLGPLDALTGAIGSIIGQLGCPQLKAIDQSQLAKLPGYNKQKVYG

Retrieve as FASTA  
Remarks Complete sequence from Genomic. Strain="SN15". 4 exons.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTTCTCATCTATCCCACTTTCGCTGGCTGCATTGGCCCCACTGGCCAATGCATTTCCTGCTGCGATAATGGAGGCGGCAGCAGCTGACCCAGAGCTTCTGGCTCGGGCTTCTGAG
ATGGCAGCGCAGTTGAAGGGACGACAGGCTGGAGCAGATGCAGCATCAGCACTATTCGAGCCCATTCCCATCTTCAACGAAAAGGCACAATTCATCAATGTCACTAAGGGCAGTGGCCAC
GAGTACGTGGCTCCAGGACCCAATGACTTGCGTGGACCTTGCCCAGGTCTGAACGCTTTCGCCAATCACA
GTGTGTACACTCCCAATAGTGCAAGTTTGCCCACTGACAGACTCCAGACT
TTCTACCACATAACGGATACGCTTCCGTCGCACAGTACATCGAAGCAACTACAAAGGTGGTTGGCATGGGCGCCAACTTGGCCCTCTTCCTGTCCGTCCTGGGAGGAGCCCTGGATGGCG
ATGTGTTAAATTGGAGTATGGGTGGCACACCGTCCCTTGCACAGGGCGGAGTTACCGGTATTCTCGGTAACGGCCTTACTGGCTCACACAACAAGTACGAGGGCGACGCATCCCCAACCA
GACCAGATCTGTACCAGGCTGGCAACAACTACAAATGTGTCACCGAGCAATTCCAGGATCTGATCAACCACTCGCCCGGTGGTGTGGTCACGCTTGATTCACTCACAAGCTTCCGCAGCG
ACAGGTTCGACGCGCAGAAGAAGAGCAACCCTTACTTCTTCAACGGACCCTTCAGTGGTGTACTCGTGCAGCCCGCCGC
GTACACCTTCATCTACCGATTCATGGCCCAACCACAGCGCC
GAGAACCCCATCGGAGAGCTTTCCTATGAGACCATCCAGTCTTGGTTCGGTGTAGAGGGAACGAACGGTAACTACAAGGCTGTTCAGGGAACTGAGCGCATCCCAGACAACTGGTACCGT
CGTGCCATCGAATACCCATACGAGACTACCTACTTCGTTGGAGATGCATTGAACGCTATCGCGCTCCACCCCAAGTTCCTCGACATCGGAGG
GTAAGCAAACTCCCATCTCAATTTCTTT
CACGCACTAACCAATTACAGTAACACTGGTACACCCGACTCCTTCACCGGTGTTGACATCGGCGATCTGACTGGTGGTGTCTTTAACGCGGAGACCCTGACTCAGGGCAACAACTTCGGC
TGCTTCCTCTACCAGGTCGCCGCTCAGGCTAAGCCAGACATTCTTCTCGGCCCACTCGACGCACTTACAGGAGCTATTGGTAGCATCATCGGCCAGCTGGGCTGCCCACAGTTGAAGGCT
ATTGACCAGTCGCAGCTTGCAAAGCTGCCTGGTTACAACAAGCAGAAGGTTTACGGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTTCTCATCTATCCCACTTTCGCTGGCTGCATTGGCCCCACTGGCCAATGCATTTCCTGCTGCGATAATGGAGGCGGCAGCAGCTGACCCAGAGCTTCTGGCTCGGGCTTCTGAG
ATGGCAGCGCAGTTGAAGGGACGACAGGCTGGAGCAGATGCAGCATCAGCACTATTCGAGCCCATTCCCATCTTCAACGAAAAGGCACAATTCATCAATGTCACTAAGGGCAGTGGCCAC
GAGTACGTGGCTCCAGGACCCAATGACTTGCGTGGACCTTGCCCAGGTCTGAACGCTTTCGCCAATCACA
ACTTTCTACCACATAACGGATACGCTTCCGTCGCACAGTACATCGAAGCA
ACTACAAAGGTGGTTGGCATGGGCGCCAACTTGGCCCTCTTCCTGTCCGTCCTGGGAGGAGCCCTGGATGGCGATGTGTTAAATTGGAGTATGGGTGGCACACCGTCCCTTGCACAGGGC
GGAGTTACCGGTATTCTCGGTAACGGCCTTACTGGCTCACACAACAAGTACGAGGGCGACGCATCCCCAACCAGACCAGATCTGTACCAGGCTGGCAACAACTACAAATGTGTCACCGAG
CAATTCCAGGATCTGATCAACCACTCGCCCGGTGGTGTGGTCACGCTTGATTCACTCACAAGCTTCCGCAGCGACAGGTTCGACGCGCAGAAGAAGAGCAACCCTTACTTCTTCAACGGA
CCCTTCAGTGGTGTACTCGTGCAGCCCGCCGC
CGCCGAGAACCCCATCGGAGAGCTTTCCTATGAGACCATCCAGTCTTGGTTCGGTGTAGAGGGAACGAACGGTAACTACAAGGCTGTT
CAGGGAACTGAGCGCATCCCAGACAACTGGTACCGTCGTGCCATCGAATACCCATACGAGACTACCTACTTCGTTGGAGATGCATTGAACGCTATCGCGCTCCACCCCAAGTTCCTCGAC
ATCGGAGG
TAACACTGGTACACCCGACTCCTTCACCGGTGTTGACATCGGCGATCTGACTGGTGGTGTCTTTAACGCGGAGACCCTGACTCAGGGCAACAACTTCGGCTGCTTCCTCTAC
CAGGTCGCCGCTCAGGCTAAGCCAGACATTCTTCTCGGCCCACTCGACGCACTTACAGGAGCTATTGGTAGCATCATCGGCCAGCTGGGCTGCCCACAGTTGAAGGCTATTGACCAGTCG
CAGCTTGCAAAGCTGCCTGGTTACAACAAGCAGAAGGTTTACGGTTAA

Retrieve as FASTA