Entry information : PnoHalPrx10
Entry ID 4234
Creation 2007-01-29 (Filippo Passardi)
Last sequence changes 2007-01-29 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PnoHalPrx10
Name PnoHalPrx10
Class Haloperoxidase (haem)    [Orthogroup: HalPrx002]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Phaeosphaeriaceae Phaeosphaeria
Organism Phaeosphaeria nodorum (Stagonospora nodorum)    [TaxId: 13684 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PnoHalPrx10
start..stop
S start..stop
GzHalPrx04 275 8e-89 24..416 14..414
PnoHalPrx09 256 8e-82 52..416 61..408
MpiHalPrx01 245 2e-77 9..416 9..407
PnoHalPrx12 216 5e-66 1..369 1..387
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 706277..706598 322 N° 2 706645..706959 315 N° 3 707009..707313 305 N° 4 707362..707697 336
join(706277..706598,706645..706959,707009..707313,707362..707697)


exon

Literature and cross-references PnoHalPrx10
Literature Birren, B. et al.

Annotation of the Phaeosphaeria nodorum SN15 genome

unpublished
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=62361741&itemID=336&view=gbwithparts
Protein ref. GenPept:   111059562 UniProtKB:   Q0U7J4
DNA ref. JGI genome:   scaffold_21 (706277..707697)
Protein sequence: PnoHalPrx10
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   425 (407)
PWM (Da):   %s   45098.39 (43282.3)  
PI (pH):   %s   5.84 (5.57) Peptide Signal:   %s   cut: 19 range:19-425
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVPRLTTALLALLPLAAAWPQVMEMNDRMKKREEPGPRAPVFKSGRPNTGLPALTFNAQEQFINVTQGSGHEFVSPGSGDIRGQCPGLNAAANHGFLPRNGIVSTEQTISGLGELYSMSPDLALFLAVVSTALAGDPVTGQWSIGGAFPATLPIFPATGIAGTHNQYEGDASIVRGDAYLNGGRVGVFQMRSWEHLYSLAEEYTLDDVAAQSDYNTRWSVANNPYYFSGPFSGMVAPAAHNFVIHFMSNHSAEKPGGTLTREVLKSFFAVTGDGPGNFVHNRGQERIPDNWYKRPFANAYNIPEVLVDVQVMNMYPGIVRVGGNTGTTNSFTGVNLGDLTGGVFNAGSLAEGNNGACFLLQASLAGLPDISNPLLGAVGSVLGWAKQQLGPLSSQFGCPQLANFDNQLFTPYPGYGYKTSGLRV*

Retrieve as FASTA  
Remarks Complete sequence from Genomic. Strain="SN15". 4 exons.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTACCTAGATTGACGACTGCACTCCTTGCGCTGTTGCCGCTCGCGGCAGCATGGCCACAAGTCATGGAGATGAACGACAGAATGAAGAAGCGGGAAGAACCTGGTCCACGCGCGCCA
GTCTTCAAATCCGGGCGTCCCAATACTGGGCTACCCGCGCTCACATTCAATGCTCAAGAACAATTCATCAATGTCACACAAGGCAGTGGACATGAGTTTGTCTCGCCTGGGTCCGGAGAT
ATCAGGGGCCAATGTCCTGGATTGAATGCTGCTGCCAATCATGGTTTCTTACCGCGGAACGGCATTGTGAGCACAGAGCAAA
GTAGGTTTATCTGGGAGGTGGAAACTTCCCCAGCTAAC
AATCACAGCCATATCTGGACTCGGGGAGCTGTACAGCATGTCTCCAGACCTCGCATTGTTCCTCGCTGTGGTTTCAACTGCTTTGGCAGGCGATCCAGTGACCGGACAATGGTCGATTGG
TGGAGCATTTCCTGCAACACTACCAATTTTCCCTGCTACAGGTATCGCTGGCACGCACAACCAGTACGAAGGCGATGCTTCTATTGTCAGGGGTGATGCCTACCTTAATGGTGGTAGGGT
GGGTGTCTTCCAGATGCGATCATGGGAGCACTTGTACAGTCTAGCCGAGGAATATACTCTGGACGACGTCGCTGCTCAATCCG
GTGAGTGATCCTGTATTCTTCTAGATGCGCATGTGCT
TACTCTTAGCAGATTATAATACGCGATGGAGTGTCGCAAACAACCCGTATTACTTCTCGGGTCCATTCTCTGGCATGGTTGCTCCTGCTGCTCACAACTTCGTCATCCATTTCATGTCGA
ACCACAGCGCTGAAAAGCCAGGCGGCACTTTGACACGCGAGGTTCTCAAATCTTTCTTTGCAGTTACTGGGGATGGACCCGGCAACTTTGTCCACAACCGAGGCCAGGAACGCATTCCAG
ACAACTGGTACAAACGACCCTTTGCGAACGCTTACAATATACCCGAGGTTCTAGTAGATGTTCAGGTTATGAACGCT
GTGAGTATGGACGTAGCATTCTTAGACTTATTGCTGATATTTC
GATAGATGTACCCCGGTATCGTGCGCGTTGGTGGAAATACAGGTACAACCAACTCTTTCACAGGTGTCAACTTGGGAGACTTAACCGGTGGTGTTTTCAACGCAGGCAGCCTCGCAGAGG
GAAATAATGGTGCCTGCTTCCTCTTGCAGGCGTCGTTGGCAGGACTACCCGACATATCCAATCCACTACTGGGCGCCGTTGGTTCAGTTCTTGGCTGGGCGAAGCAGCAGCTGGGCCCAT
TGAGTTCGCAATTTGGCTGCCCGCAGCTCGCCAACTTTGACAACCAGTTATTCACCCCGTACCCTGGTTACGGCTACAAGACCTCTGGACTCAGAGTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTACCTAGATTGACGACTGCACTCCTTGCGCTGTTGCCGCTCGCGGCAGCATGGCCACAAGTCATGGAGATGAACGACAGAATGAAGAAGCGGGAAGAACCTGGTCCACGCGCGCCA
GTCTTCAAATCCGGGCGTCCCAATACTGGGCTACCCGCGCTCACATTCAATGCTCAAGAACAATTCATCAATGTCACACAAGGCAGTGGACATGAGTTTGTCTCGCCTGGGTCCGGAGAT
ATCAGGGGCCAATGTCCTGGATTGAATGCTGCTGCCAATCATGGTTTCTTACCGCGGAACGGCATTGTGAGCACAGAGCAAA
CCATATCTGGACTCGGGGAGCTGTACAGCATGTCTCCA
GACCTCGCATTGTTCCTCGCTGTGGTTTCAACTGCTTTGGCAGGCGATCCAGTGACCGGACAATGGTCGATTGGTGGAGCATTTCCTGCAACACTACCAATTTTCCCTGCTACAGGTATC
GCTGGCACGCACAACCAGTACGAAGGCGATGCTTCTATTGTCAGGGGTGATGCCTACCTTAATGGTGGTAGGGTGGGTGTCTTCCAGATGCGATCATGGGAGCACTTGTACAGTCTAGCC
GAGGAATATACTCTGGACGACGTCGCTGCTCAATCCG
ATTATAATACGCGATGGAGTGTCGCAAACAACCCGTATTACTTCTCGGGTCCATTCTCTGGCATGGTTGCTCCTGCTGCTCAC
AACTTCGTCATCCATTTCATGTCGAACCACAGCGCTGAAAAGCCAGGCGGCACTTTGACACGCGAGGTTCTCAAATCTTTCTTTGCAGTTACTGGGGATGGACCCGGCAACTTTGTCCAC
AACCGAGGCCAGGAACGCATTCCAGACAACTGGTACAAACGACCCTTTGCGAACGCTTACAATATACCCGAGGTTCTAGTAGATGTTCAGGTTATGAACGCT
ATGTACCCCGGTATCGTG
CGCGTTGGTGGAAATACAGGTACAACCAACTCTTTCACAGGTGTCAACTTGGGAGACTTAACCGGTGGTGTTTTCAACGCAGGCAGCCTCGCAGAGGGAAATAATGGTGCCTGCTTCCTC
TTGCAGGCGTCGTTGGCAGGACTACCCGACATATCCAATCCACTACTGGGCGCCGTTGGTTCAGTTCTTGGCTGGGCGAAGCAGCAGCTGGGCCCATTGAGTTCGCAATTTGGCTGCCCG
CAGCTCGCCAACTTTGACAACCAGTTATTCACCCCGTACCCTGGTTACGGCTACAAGACCTCTGGACTCAGAGTTTAG

Retrieve as FASTA