Entry information : PnoHalPrx13
Entry ID 4237
Creation 2007-01-29 (Filippo Passardi)
Last sequence changes 2007-01-29 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PnoHalPrx13
Name PnoHalPrx13
Class Haloperoxidase (haem)    [Orthogroup: HalPrx002]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Phaeosphaeriaceae Phaeosphaeria
Organism Phaeosphaeria nodorum (Stagonospora nodorum)    [TaxId: 13684 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PnoHalPrx13
start..stop
S start..stop
AteHalPrx03 459 2e-160 8..436 11..451
AfumHalPrx02 422 5e-146 38..436 34..443
GzHalPrx04 270 2e-86 31..406 11..398
MpiHalPrx01 252 6e-80 5..406 4..391
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 270696..271023 328 N° 2 270489..270638 150 N° 3 269934..270435 502 N° 4 269543..269873 331
complement(join(269543..269873,269934..270435,270489..270638,270696..271023))


exon

Literature and cross-references PnoHalPrx13
Literature Birren B. et al.

Annotation of the Phaeosphaeria nodorum SN15 genome

unpublished
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=62361750&itemID=138&view=gbwithparts
Protein ref. GenPept:   111063166 UniProtKB:   Q0UJQ4
DNA ref. JGI genome:   scaffold_12 (271023..269543)
Protein sequence: PnoHalPrx13
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   436 (417)
PWM (Da):   %s   46921.78 (44983.8)  
PI (pH):   %s   5.37 (5.20) Peptide Signal:   %s   cut: 20 range:20-436
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLSFAALALSSSSFLVNAFPALDTGHLDGLTPERLSAAIRSVDEFKATKRFLVDVTKPIEITGRHAFKAPGRFDQRGPCPGLNALANHGYISRDGITSFAEVVTAVNQVLGMGIETALILGAMGTVWTGNPLSLNPGFSIGGAANGPDNILGNVLGLLGDLRGLQGSHNWIEADSSLTRNDLYVTGNAWTMNTTLFWDFHDRADENGVLSMDLLADQAARRWNDSVSTNPAFWYGPVTGMVARNAAMFFLGRLLSNHTAEHPEGILTQDIFRKFFAVYETGDGKFEYREGHETIPANWYRKPVEYGLVPLNLDIVSWIMKHPVLGSIGGNTGTVNSFSGLDMHNITGGVLNSVSLLENNNLLCFVFEVLKTFLPNSLSPLLKTLEVPINLITDTLAAPILSLACPAWKDMTAGGEPLWDAIQHSFEGASKAGSGL

Retrieve as FASTA  
Remarks Complete sequence from Genomic. Strain="SN15". 4 exons.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCTCTTTCGCGGCCCTTGCTCTGTCATCGAGCAGTTTCCTCGTCAATGCTTTCCCTGCTCTGGACACTGGACACCTCGATGGCCTTACACCTGAGAGATTGAGTGCTGCTATT
AGATCAGTTGATGAGTTCAAGGCTACAAAGAGGTTTCTCGTAGACGTCACCAAGCCTATCGAAATCACTGGTAGACACGCCTTCAAAGCGCCTGGCAGATTCGATCAACGTGGACCTTGT
CCTGGCCTAAATGCGTTGGCGAACCATGGTTACATTTCTCGCGATGGCATTACCAGCTTCGCAGAAGTTGTGACAGCTGTAAATCAAG
GTTTGTCTTGACATTCATTTACTACTAGTCAA
ACAAAGCTGACAATGTGTGATCCAGTGCTGGGCATGGGCATAGAGACTGCACTCATACTTGGTGCTATGGGTACTGTCTGGACAGGCAATCCACTTTCGTTGAACCCGGGTTTCTCGATC
GGCGGCGCGGCCAATGGTCCCGACAACATCTTAGGAAATGTTCTTGGCCTCCTTG
GTGTGTGGTATCTTGCGAACTACCTCAATGAACATTATGCTCATATCTCACAGGTGATCTTCGTG
GCCTTCAAGGTTCGCACAACTGGATCGAAGCCGATTCTTCGCTCACGCGCAATGACCTCTACGTCACTGGAAATGCATGGACTATGAACACGACGCTGTTCTGGGACTTTCACGACCGTG
CTGACGAAAACGGTGTTCTTTCAATGGACCTGTTGGCGGACCAAGCTGCCCGCCGTTGGAACGACAGCGTTTCGACGAACCCAGCGTTCTGGTATGGCCCCGTTACTGGCATGGTTGCCC
GCAACGCCGCTATGTTTTTCCTTGGGCGTTTATTGTCAAATCATACTGCCGAGCACCCTGAGGGTATCCTCACCCAGGATATCTTTAGGAAGTTCTTCGCGGTTTACGAAACTGGAGATG
GCAAGTTTGAGTATCGTGAGGGTCACGAGACTATTCCTGCCAACTGGTATCGCAAGCCAGTAGAATATGGCCTCGTACCTCTGAATTTGGACATCGTTAGCTGGATCATGAAGCATCCTG
TTCTTGGCAG
GTAAGTTCTAGCTCTATGCATAACCCGACAGGCTGATCATACATACTAACACCAATGCAGCATCGGCGGCAACACTGGCACTGTCAACTCCTTTTCCGGTCTTGACATGC
ACAACATCACTGGCGGCGTGCTGAACTCAGTATCTCTTCTTGAGAACAACAACCTCTTATGCTTCGTATTCGAGGTACTCAAAACCTTCCTCCCCAACTCGCTCTCTCCGCTATTGAAGA
CTCTGGAAGTCCCGATCAATTTGATAACGGACACTCTGGCAGCGCCTATCTTGAGTCTAGCATGCCCAGCCTGGAAAGACATGACAGCTGGTGGTGAACCACTGTGGGATGCTATTCAGC
ACTCGTTCGAGGGGGCGAGCAAGGCAGGATCTGGTCTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCTCTTTCGCGGCCCTTGCTCTGTCATCGAGCAGTTTCCTCGTCAATGCTTTCCCTGCTCTGGACACTGGACACCTCGATGGCCTTACACCTGAGAGATTGAGTGCTGCTATT
AGATCAGTTGATGAGTTCAAGGCTACAAAGAGGTTTCTCGTAGACGTCACCAAGCCTATCGAAATCACTGGTAGACACGCCTTCAAAGCGCCTGGCAGATTCGATCAACGTGGACCTTGT
CCTGGCCTAAATGCGTTGGCGAACCATGGTTACATTTCTCGCGATGGCATTACCAGCTTCGCAGAAGTTGTGACAGCTGTAAATCAAG
TGCTGGGCATGGGCATAGAGACTGCACTCATA
CTTGGTGCTATGGGTACTGTCTGGACAGGCAATCCACTTTCGTTGAACCCGGGTTTCTCGATCGGCGGCGCGGCCAATGGTCCCGACAACATCTTAGGAAATGTTCTTGGCCTCCTTG
GT
GATCTTCGTGGCCTTCAAGGTTCGCACAACTGGATCGAAGCCGATTCTTCGCTCACGCGCAATGACCTCTACGTCACTGGAAATGCATGGACTATGAACACGACGCTGTTCTGGGACTTT
CACGACCGTGCTGACGAAAACGGTGTTCTTTCAATGGACCTGTTGGCGGACCAAGCTGCCCGCCGTTGGAACGACAGCGTTTCGACGAACCCAGCGTTCTGGTATGGCCCCGTTACTGGC
ATGGTTGCCCGCAACGCCGCTATGTTTTTCCTTGGGCGTTTATTGTCAAATCATACTGCCGAGCACCCTGAGGGTATCCTCACCCAGGATATCTTTAGGAAGTTCTTCGCGGTTTACGAA
ACTGGAGATGGCAAGTTTGAGTATCGTGAGGGTCACGAGACTATTCCTGCCAACTGGTATCGCAAGCCAGTAGAATATGGCCTCGTACCTCTGAATTTGGACATCGTTAGCTGGATCATG
AAGCATCCTGTTCTTGGCAG
CATCGGCGGCAACACTGGCACTGTCAACTCCTTTTCCGGTCTTGACATGCACAACATCACTGGCGGCGTGCTGAACTCAGTATCTCTTCTTGAGAACAAC
AACCTCTTATGCTTCGTATTCGAGGTACTCAAAACCTTCCTCCCCAACTCGCTCTCTCCGCTATTGAAGACTCTGGAAGTCCCGATCAATTTGATAACGGACACTCTGGCAGCGCCTATC
TTGAGTCTAGCATGCCCAGCCTGGAAAGACATGACAGCTGGTGGTGAACCACTGTGGGATGCTATTCAGCACTCGTTCGAGGGGGCGAGCAAGGCAGGATCTGGTCTGTGA

Retrieve as FASTA