Entry information : TsPrx72 (Thhalv10004548m)
Entry ID 4257
Creation 2006-12-27 (Christophe Dunand)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-12 (Christophe Dunand)
Peroxidase information: TsPrx72 (Thhalv10004548m)
Name (synonym) TsPrx72 (Thhalv10004548m)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx72
start..stop
S start..stop
ThPrx72 697 0 1..336 1..336
NoffPrx72-1B 668 0 1..336 1..336
NoffPrx72-1A 666 0 1..336 1..336
CrubPrx118 666 0 1..337 1..337
Gene structure Fichier Exons


exon

Literature and cross-references TsPrx72 (Thhalv10004548m)
Literature Deng,Z., Wang,W. and Xie,Q. Structural Analysis of 83-Kilobase Genomic DNA from Salt Cress (Thellungiella halophila): Sequence Features and Microcolinearity Between Salt Cress and Arabidopsis thaliana.
DNA ref. Phytozome 12:   scaffold_6 (104728..106390)
Protein sequence: TsPrx72 (Thhalv10004548m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (313)
PWM (Da):   %s   37407.01 (34829.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.95 (9.03) Peptide Signal:   %s   cut: 24 range:24-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKSLNILIVALSLIAFSPLCLCSKAYGSGGYLFPQFYDHSCPKAQEIVQSIVAKAFAHDPRMPASLLRLHFHDCFVKGCDASILLDSSGTIISEKRSNPNRDSARGFELIEEIKQALEQ
ACPETVSCADILALAARDSTVITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTILTKFKRQGLNLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDLTLNQYYAYVLRKQCP
RSGGDQNLFSLDFVTPFKFDNHYFKNLIMYKGLLSSDEILFTKNRESKELVKLYAENQEAFFEQFAKSMVKMGNISPLTGMRGEIRRICRRVNHAY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
CDS
Send to BLAST