Entry information : AtPrxII03 (At1g65970 / TPX2 / PRXIIC / PeroxiredoxinIIC / Thioredoxinreductase2C / AtPrxIIC)
Entry ID 4347
Creation 2007-01-18 (Christophe Dunand)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-12 (Achraf Jemmat)
Peroxidase information: AtPrxII03 (At1g65970 / TPX2 / PRXIIC / PeroxiredoxinIIC / Thioredoxinreductase2C / AtPrxIIC)
Name (synonym) AtPrxII03 (At1g65970 / TPX2 / PRXIIC / PeroxiredoxinIIC / Thioredoxinreductase2C / AtPrxIIC)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Mixed tissues
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrxII03
start..stop
S start..stop
AlyPrxII03 328 1.21e-117 1..162 1..162
AtPrxII04 325 1.18e-116 1..162 1..162
AlyPrxII02 318 7.5e-114 1..162 1..162
AtPrxII02 316 5.35e-113 1..162 1..162
Gene structure Fichier Exons


exon

Literature and cross-references AtPrxII03 (At1g65970 / TPX2 / PRXIIC / PeroxiredoxinIIC / Thioredoxinreductase2C / AtPrxIIC)
Literature Haas,B.J., Volfovsky,N., Town,C.D., Troukhan,M., Alexandrov,N., Feldmann,K.A., Flavell,R.B., White,O. and Salzberg,S.L. Full-length messenger RNA sequences greatly improve genome annotation Genome Biol. 3 (6), RESEARCH0029 (2002)
Protein ref. UniProtKB:   Q9SRZ4
DNA ref. Phytozome 12:   Chr1 (24558229..24557527)
Cluster/Prediction ref. Phytozome Gene 12:   19653389 UniGene:   At.66846
Omic ref. ePlant:   At1g65970 TAIR:   At1g65970
Protein sequence: AtPrxII03 (At1g65970 / TPX2 / PRXIIC / PeroxiredoxinIIC / Thioredoxinreductase2C / AtPrxIIC)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17289.92  
PI (pH):   %s   5.23
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFIGKAEELKSKGIDEIICFVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDK
GLGIRSRRFALLLDNLKVTVANVESGGEFTVSSAEDILKAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 2 introns), 6 cDNA and 43 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
Terminator +
Send to BLAST
Send to cis Analysis
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST