Entry information : Mt1CysPrx01 ( Medtr4g094720.1[4.0])
Entry ID 4377
Creation 2007-02-02 (Christophe Dunand)
Last sequence changes 2016-04-22 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-04-25 (Christophe Dunand)
Peroxidase information: Mt1CysPrx01 ( Medtr4g094720.1[4.0])
Name (synonym) Mt1CysPrx01 ( Medtr4g094720.1[4.0])
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Immature seeds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Mt1CysPrx01
start..stop
S start..stop
Vv1CysPrx 373 1.34e-133 1..218 1..219
Ecam1CysPrx03-2 369 6.42e-132 1..218 1..219
Egu1CysPrx03 368 1.1e-131 1..218 1..219
Egr1CysPrx03 368 1.1e-131 1..218 1..219
Gene structure Fichier Exons


exon

Literature and cross-references Mt1CysPrx01 ( Medtr4g094720.1[4.0])
Literature Boudet,J., Buitink,J., Satour,P. and Leprince,O.H.L. Expression of 1-Cys peroxiredoxin in relation to desiccation tolerance in seeds of Medicago truncatula
Protein ref. UniProtKB:   Q6E2Z6
DNA ref. Phytozome 12:   chr4 (38843435..38842616)
mRNA ref. GenBank:   AY594329
Cluster/Prediction ref. Phytozome Gene 12:   31110627 UniGene:   Mtr.6778
Protein sequence: Mt1CysPrx01 ( Medtr4g094720.1[4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   218
PWM (Da):   %s   24384.37 Transmb domain:   %s   o10-29i
PI (pH):   %s   6.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLTIGDTIPDLEVDTTQGKIKLHHFCSDSWTILFSHPGDFTPVCTTELGKMAQYASEFNKRGVMLLGMSCDDLESHKEWIKDIEAHTPGAKVNYPIISDPKREIIKQLNMVDPDEKDS
NGNLPSRALHIVGPDKKIKLSFLYPAQTGRNMDEVLRVVESLQKASKYKIATPANWKPGEPVVISPDVTNDQAKDMFPQGFKTADLPSKKEYLRFTNV*

Retrieve as FASTA  
Remarks Complete sequence from genomic and ESTs.
DNA
Send to BLAST
CDS
Send to BLAST