Entry information : Mmul1CysPrx (PrxVI)
Entry ID 4428
Creation 2007-01-25 (Nicolas Rouhier)
Last sequence changes 2007-01-25 (Nicolas Rouhier)
Sequence status complete
Reviewer Filippo Passardi
Last annotation changes 2010-11-22 (Myriam Duval (Scipio))
Peroxidase information: Mmul1CysPrx (PrxVI)
Name (synonym) Mmul1CysPrx (PrxVI)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Cercopithecidae Macaca
Organism Macaca mulatta (rhesus monkey)    [TaxId: 9544 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Mmul1CysPrx
start..stop
S start..stop
Mnem1CysPrx 456 2.81e-166 1..224 1..224
Mfa1CysPrx 454 1.38e-165 1..224 1..224
Ptro1CysPrx01-2 451 2.95e-164 1..224 1..224
Ptro1CysPrx01 451 2.95e-164 1..224 1..224
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '4428' 'join(203122798..203122892,203126718..203126874,203130660..203130806,203131568..203131714,203133072..203133200)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 203122798..203122892 93 N° 2 203126718..203126874 155 N° 3 203130660..203130806 145 N° 4 203131568..203131714 145
N° 5 203133072..203133200 127  
join(203122798..203122892,203126718..203126874,203130660..203130806,203131568..2 03131714,203133072..203133200)


exon

Literature and cross-references Mmul1CysPrx (PrxVI)
Protein ref. GenPept:   XP_001101473
DNA ref. GenBank:   NC_007858.1 (203122798..203133200)
Protein sequence: Mmul1CysPrx (PrxVI)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   224
PWM (Da):   %s   24910.1  
PI (pH):   %s   5.81
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGGLLLGDEAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSDINAYNCEEPTEKLPFPIIDDKNRDLAILLGMLDPAE
KDEKGMPVTARV
VFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP*

Retrieve as FASTA  
Remarks Genomic (automated prediction).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCGGAGGTCTGCTTCTCGGGGACGAGGCTCCCAACTTTGAGGCCAATACCACCGTCGGCCGCATCCGTTTCCACGACTTTCTGGGAGACTCTCGTAAGTGGCCACCGCGTAGCCCT
GCCCTGGCCTTGGTTGCGCCTGGACTCGGAGGTGCCTTCCCTATTTCTTCTCCCTTCCGTCCTCCCTGCCGCTCAGCCCCCTGCGCCGCTCGCCCCCTCCCCCGCACCGGTTTCGGCGCG
CGCCAGGCCGTGTGGCCCCTGCTCAGCGTCGGCTGCGCCCCCGGGAGCTGGCACCCCTTCAGCCTGCCCTGCGCGAGCCACTGGATCCCTCCAGGCCTCCCCGCCTCCGGCGTGGCTGGG
CAAGGCCACGCCAAGGTGGGGGATGGGGAGGACAAAATTGGGTTCTGCAGGTTCTGGAAACTCACTGCCCGTGGGAGGGTTTGTTGTCCGTTGAACTCGTCTTAGTAAACTGCAGGTAGC
GTGGTCAGGCCGAGGGCGCAGGGGCGGGTCGGCATTGGCGATCACTTCCCCGGTCTAGTGCCCAGGGTCGCACCGCCCTCCCTCCCACCCTCCGTTCTGGAATTTGCTCCCTGGGGAGGA
TGGGTGTCTGAAGCCAAAGTCGGAGGACACAGCTGCTGGCTATATGTTACAGGAAGGCCAACGTATTATCTGAGGGTGCAGGGTATTTGCAGGCTTCTGGGCACAAAATGTGAAATTTAA
AACCACTAGCTGCCTAATCGGTGGCCGAAAGACTTTTTGTCCAGACCCTCCTTCAATGACCAAGATATGATTTGATAACAGCTTTAGGAAGAGCCAAGAACACTCTGTGTAGGTGTGCCT
TCAGAGATTCCAGAACTTGCAACGCTTTTCTGACGCCGTTCAGCTGTAGTAGCGTATTCTTGCTAGTGATGGCCGTTCCAGGCTCCAGGACACGTGTACTCCCAACTTTGAGACTCTTTT
GTTTCCCAGTGGCTTGCGCCTCACTGTCCTCTCCACTTTCTGCCTTGCTTCCAGCACATAAGCTTGCTGATGATAGCCAAATTGATGACCTGTGATCTGACTTGGCAGTTTTGCCATTAT
GAATAGGAGTAGTGAATCAGTGTTGCCTTTTTTTTTTTTTTTTTTTTTTGGCAGCTCCTGGATTAGCAAACTGGAAGTTGCTTAGTTTTCATCAGAAGCATTCCAGGCATGTCTAGTTAT
ATTATGGTTCTGGAGTTCTAGTGGTCCCACTACACTGTGGGGCTCCGAGGTTTGACGACAGTTCTTCCCCAGTTTATATCCTTTTTATGTACAGTATCCAGGGAGACAAAGAGAGAGGCT
TATGAAATTAATCAATGATTGGACAGGGCTGTGCAGAGAACCAGGGAGAGATTCTTACACATCATGTGCCTACCCGGACCCTTACAACCTCTTAGGTCCCTTTTCCAGCCACTGAATAGA
GGAAAAAGCTTTGTGAAAGATAGGACTAGGCCAGAAAAAGGTTGAAAACTTGAATATTCAAACCTTGAACGCAGAAAAATACTTGAGAAATACAGCTTATGGCCAGTCTTATACTTAGGA
TCTAGGTAGTAGTATTTCTCCAGTAATCCTTGGGATTTTTAGAGTTGTGTTCCTTCCCATTTCTGCCTTCAGCCCTCACCCCCATGAAACATAAACTATTTCCAGAACTCTTAGCTTGTG
TAGATTAAATATTAGCATAAAACATATTTAACTGTTCCAACAATTAGAAATGTTGTTGCTTTTTAAGCTAACCATACTTTTTTGGGGTTTCGTTAATGTTTATTAGCCTCTAGATCCATC
TAGATTTGATCAAAAGTGGTACTTTATCAGCCATAGTTAGGAACACGATAAAAATATCTGCATTTATTAACTAATAGACAAGTCTGCCTAGGATCAGGCGTAGTATTCCCTACCTTACCA
GGAAGAGAAGTTTGAGCCTTTTATATGTTTATGACATGGATTTTTGCCTGATTTTTCCAAACTCTATTCTGTATATGATCCCAAGTCAGACTGTCAATTTTTGATCCAGGTATTTTTGAG
GAGAAAAAATTAAAATATCTTTCTCTACCTTACCCCTGATCATTGTAAACAACTAAAGAGGTTGGGTGCTACATTGGGTGAGTTTACTGGACCTTATCACTGTTTCTGTAAGTGGTAGAA
GTAGCTTCTTCATAGCACATCTTCACTACGCAAAATATGTGTTTTCCGGGGTCTTCTGGGGCTTAGTAAATGGGAACCATTCTCTTGAAGGAGGAAACCTTTTGTCTTTTGAAAATGGGT
AAGAAAGAAAACGGGAGAATGTCACTGAATTACTCTTAAGTGCAGCAGTAGGAAGACTTAGAGGGAAAGAAAGGCCAAGGTGAGACATTCTTGGAGTTTATCCTACTTGTAGCCACGAGG
TAAACTGGAGTTTCACTTCTGAGGGAGGGAAGGACGTGAACTGGCTTAAAACCAGTTCCTTTCGCATGATTCAGCAAAACAGTCTCTGCCGACTGACAATGGAAAAAGAACTCCTAACTT
TTCTAATTCATCCTCCCTTTAACAATACAGGAGGAAACGCCCTGTTCCATTTCTTCTCAACTTTTGGAGACCTTCTGTTAAGTCTCATCTAACCATTAAATAGATTGTTTTCCATAGAAT
CTAAGGCCTAGATTTTACTCATAGTGATATTATCTACTTCAAAAGATATACTCTATGTTCTTCCTTTTGCCCTTCATAATAAAGTGAACATAGTGCACACCTCCACAATCTTAAAAAATA
TATATTAGCTTTCTTCCCAGTCTTGCCATAGGGCCCTCCATCCTTTTCGTAAGAAGATCTTTTTCCTTCTTGAAACCTTGGGAGTTGAGTGGAAGCTGTAAGTGGGAAGGAGGTGCCCTT
GTCTTTGCTTGTTCTCTGTACTCAGGGAAACTTCGGAAAGGTCAGCTTGGCATCTAGGCAAGATTTAGTTATCTGCTAGTTTAGGATCCCGCCTAAATCATCTGGTTTAGGATAGTTTAA
ATTGATGGGGATGTGGAGAACTGAGTGTTCAATTTTCCTTTTCAGTTGAAAGAGTAGTTTCTGTTGCCAAGGAGAAGGAAATGGTACTTCAGCTTTCTTAGTGGCCGCTTGAAACGTGCT
CAAAATCTATAAAATCTTAGACAATGATGACTTAGATCTTAGTATTTACCTAGGAATTTGCTATTGTAGAAATCTACATTGTAGGCTATCAAAATTCTACCTGCTTGGTCTGAAGAAAGA
AGAAAAACTGCAAATGAAGAGATAGGTAAAACTGTTAAGGTGATACTGTTTTGTCAGAGTATAAATATTGGGTGTCCTGTTTGGCAGGTTAGATCAGTAAAGTGGTTTTACAAGATTTTG
TATCCACTTGCTTCGAAGAAACCAAGTGTCGACTTCAATTTTTACATATAAATAGAGGATAGAAACCTATTTATTTCAGATTACATAATCTGTTTATTATTGTAGTCAGGCATTTGTTTG
GATTGAGAGCATACTGGGACATCCATTATTGGAGCTGAATGTCATGGTCTGTGCTAGAAAAAATGTAGAAAAGGATAAGAAGAAATAATTAAGTTTTTTCAGTAAGCTACTTGGCTTGAA
CAGCACAGATTTTATTAGCCAAAAAGGAGTCAGGGTGGCACCATAATTATTAAAGGAAGCAACACCTTAAAATTAGTCTTTTTAAATATGTGTCATCTTGAATTTCATATCTTTGATTAA
ATCGGGCTATAAGCATAGGCTTCTCTAGAGGTAAGTAGATTGAAAAGCATTCCTCAACAGAAAAGTTTAGAAGTAAATATCGTCATAAGCATTCATTTAAAAAAGAAAGCCTGTTTTTGA
TTCAGAAGTTGTGACTTTTCATTCTCTGTGATGTTGGTGATAACTCTTCATTCAACTGTGACCTTGTTTTTCTTCCTTTCAGATGGGGCATTCTCTTCTCCCACCCTCGGGACTTTACCC
CAGTGTGCACCACAGAGCTCGGCAGAGCTGCAAAGCTGGCACCAGAATTTGCCAAGAGGAATGTTAAGTTGATTGCCCTTTCAATAGACAGTGTTGAGGACCATCTTGCCTGGAGCAAG
A
GGTTAGTATCAATTGGCATGAACTTTGAGCCTGAGATTATAGGTCAAGTTATAAATTATAGAGTCCTTGGTTTTTGAGGTTAAGGTACAAGTAAGCTTTAGGTTCAAAGTTCACTGATTA
TTTGAAAATTTCAGTTGAACCACACAGTGATCACATTGCTAAATCCATTGGTCAGTCAATTCTCAGACCTCATCTTGGCCTGCCAGCAGCATTCAACCTAGGTGATCACTGTTTTCCTTT
CTTGGCTTCTAGGACACCACATCCTAGCTGTTCCTGCTCACTGATTCTTCATCTCCCAACTCCTAATTTATGCTGAAGTTACCCTGAACTTATTTCTTGGACCTCCTCTCTTTTCTGTCT
GTACTCTTTCCCTTGGAAATGCCTTTAAATACCATCTATGTGCTGTGGTTCTCAAATTTTCATCTCTAGGCCAGACGCTTTGAGGTTCATGTAACCACTGCCTACTTAGCATCTCTCCTG
GGATGTCCAGTCATCTCAAACCTAGCATGTCTAAGTAGGCCTCATTCTTAAATCCAGAGTTTTATTCATCTAAGCTAATGGCAACTGCATTTTTATAATTGTTCACGCCCCAAATCCAGG
AGCCATTCTGAATTCTTCATGTTTTTTCACATCATAACATCTGATTTATCCTCAAACTTGTCAGCTCTACCTTCAAGATATGTCCTGTATCATGGATGGAAGACTGACTCCCAAGGGATC
TGTGTGACTTACCCTCACCTCTTTTGGGTCTCAACTCACAGGACATTTCATCAAAGGCTTTCTTGTCCTCATTATCTAAAATGATAACTCCTTTTCACATTCACTATCCCCTCCTCCTCA
GCACTCAAATACTCTGCATATTACCTGTTTAGTTTGTTTCTTCCTAGTAGAGTGTAAACTCAGCAGGAACAGAGACTCCTGTTTTGTGCACTGCTGGAACGATGCTCACTACTCAGTACG
TCTTAGGTGATCAGTCAGTATTTGTTGAATGAATTAACTGAAGGAAATACCTACTTTTAGCAAAAGAATTTACTTGAACAATAAATTTGGTGGTCTGAATTTACCTTGAAAACATTTTAA
GGACTTCACTACAACATGCAGTTAAGTAATAATGGTAACTACTTTTTGAGGGATGTATACTAGAAACTATGTCAAGCATGTGTAGTTGAATAAAAGATGTATTGACTTGTGAGTTAGGGA
TCTGTGGCTGCATCCTATAGCAGTTAACACTAGTTAATCCTAAATATCTGAGACTAGAAGAATCATGTGTAGGAGAAAAAAGAAGGGCAGTTATCTATCTTGAAATAGAATTTTTTTCAT
TCCTTACATTTCTCAGTGAGTGGTAACTGTAGTTTTCACTATCGTTTTTCATTTTCATTTTTGCAGTTGAGAATACTTTTTTCACTTAGAAACTTGGAGGGACTTGCCCAAGACTGCCCA
ATGGCAATGAGATTTGAATCTCAAATCAATGGTCTTTTTAATACAAGATGATAAAAAGTAGGATTTAGCCTAATTTAGGATAGAATAAAGCCAAATAATTTAGGATACTTTCTTTGGTGT
TCATGGGTGTAATATAGTGTCCATCATGCAAGTGGCAGAGTAGAGAATTAGTGCATAGCAATAATTAAAGTGACATATTGCCAAAGGAGGTGTTTGTAGCCCATTATAGAATAGCTTTTA
AAGTATAGAAGCATACACAGGTTTATTTTACCCTGAGCTTCTGCCTTAGAAGTTTTCACAATTGTGATTACATTGAATAGGAAAAAAGTCTGAACTACCAGAAGGAGTGCCCAAACTTTG
ACATACACCTGATATATAATAATCTGCCTCTAGCATGAGACTATATTAATTATTATTTAGCTCTGGTGACTTAATAGGCAGCCAGTGACAACAGAAAGTTAAGATAATAAAATGAAGGAA
TGTTAGAATGTGTTGTCATCCAGGAGCCTGAGGCAGGAGAATGGCTTGAACCCAAGAGGTGGAGGCTGCAGTGAGCTGAGATCGTGCCACTGCACTCCACCTGGGCGACAGAGCAAGACT
CCACCTCAAAAAAATTAATAAATAAATAATAAGAATTTGTTGTTATCCACTTCAGAGCTCATCAATGCCACATTTGTTACATCTCTGTTGAGAAATCCACAATGGTTTTGTATCTGCTAT
GCCACCAAGCTCCTGTTTTACTTTCAAGCCTACACATAATAGACCTGATTCCAATTTTAAATCATTTTTTCCATTACTTGCTAAACTCTGTCCAACTAAGTTCCTCACTCTCCCATCAAT
AGTTTATGTACAGAGTTGCCCACATGTTTCATTAATATCGTTCCTGGACAAGTGCACTAGCTCACACCTATAATCCCAGCACTTTGGGAGGCCAAGGCAGGTGGATCAGAAGGTCAGAAG
TTCAAGACCAGCCTAGCCAAGATAGTGAAACCCCGTTTCTACTAAAAATACAAAAACAAATTAGCCGGGTGCGGTGGCGGGCGCCTGTAATCCCAGCTATTCAGGAGGCTGAGGCAGAGA
ATTGCTTGAACTTCGGAGGCAGAGGTTGCAGTAAGCCGAGATTGCACCACTGCACTCCAGCCTGGGTGATACAGCAAGACTCTGTCTCAAAAAAAAAAAAAAAATTTTTTTATATATATA
TATACACATATATGTGTATATACATATGTGTGTGTGTGTATGTGTGTGTGTAGTTCTGCTCCCTAGAATGCCTTTCTTTTCTCTGTGAAAAATCTTACCCATCCTTCAAGGGCCCAGATA
GAAGTCCTATTCTTTTCTTGAAGCCTTTTCTAACTCTTGGAGTCCTACAAATGGGAGTGTTCAGTACTTCAGCATTTACCGTCCACCTTTTAACATTAGTCTTGCATTTGCTGCTGCTTC
ATGCTGGAATCATCTCTAACCAAATTAGAAGTTCCTTTGAAGGCAGGAGCCATGTCTTACTCATCTGTATTCCACATGTACTTACCATAATGCTTAGCCCACCTTAAGTGCTATATCAAT
GCTTAATCAAATAACAAAACTAATTTTTTTTTTTCTCCAAAAGCTTCCAGGGATAGAAAAAGTAGAAATAAATGGATGAATAAAGTTTTACTAGGGAAGGAGGGAGACATATCATTTTTC
CTTAGTTCAGACTTGAAATGCTTTGTTTTCTGTTTGAATTTCACCCTAGTTTAGGTTTACCTCTGCCTTTTCACCCATTTATTTTTGACTTGTCCTTCAAGTATATATTCAACTCTCCAT
TCTTGTGTTTGCTTTGTTTTGTGATTTTTTGTTTGTTTGTTTTTTGTCATTTCTTACTATTTGTCTTGTAACTTAACATCTGAGTCAGGGTGCTTTTGAGGCAGGGACCAGAGCTATAAG
ATTTTCTTTACATATGGTATTATTTCTAGATGTGATGGATTTAACAAACCTGTTGTATCTGATGGTTTTTACAGTATTTGGGTATCCAGAGGTGCCTTGTATTTGGATGTAACTAAATTA
TTGCAATGTTAAAGGGGTTGCTGCTGTTTTCTCATGGCAGTGGAAGCATGCTGAATTTAAGAGAACTGGGCATGAAAATGGCTTTGGTCCATGATTACAACCTAAGTACTGTACTCTGCT
GTTATTCCTGGCAATAATTGGAATGAAAAGTGTTGATTTACTCACTTTTTAAAATTAAAATTGCTTACAGAAAATTACTGTGATTTGGTCCTCTTTCCTGTCTTGCAAGGTGATGGCTGT
TAACTGATGAAATTCAGAGCATGTGTTAAGTTTAGATTCCTCTTTCCCCTTTTACTTGTGTTTCAGGATATCAATGCTTACAACTGTGAAGAGCCCACAGAAAAGTTACCTTTTCCCATC
ATCGATGATAAGAATCGGGACCTTGCCATCCTGTTGGGCATGCTGGATCCAGCAGAGAAGGATGAAAAGGGCATGCCTGTGACAGCTCGTGTG
TGGTAGGTCATACAAATTCATTTTGTA
GTCAGCATAACTGATCAGGCTGTATGTCCATGTAAATGCTCGTACCAGCTAGAGGAGATAGGGGAGTATCTACAATTATGAAATAACTGTGTATTGGCAACAATATCACTGATTATCTGT
AATGCTGATGCAAAGTGGCTGAAATTTTCAACTAAATTTTTCAACTGCTTAATTCATAGTTCATGGAAATCTACAAAAAAAAAAAAAAAAAAAAGTTGTTTATCCTAAAATGTCCTCCAG
AATTGAGAAACCTTTTCATAGCTCTCCTGACCACCCTGTCTTTAAAGTGATTGGCCATATCCTTCTTCATAAGGCAGCTCTGTTTTTAAATTTTTATTTGTTCTGTCCTCTGTCCACTAG
AGAACAAACCCGATCCCTCATCTGAATAAATGCACAACTATTCAAGGAACAATATCAACTCCCATTAGTATTATTTTTATGATAGTCATCCCCAACGGACATAGCCTTTCCTGGATTAAA
TTTGCATATCAGTTTTTCTTACTGGGATAGCCAGAACCAAATGGAATTCCCTTCTAAGTTTAGAAAATAACAGAGAGAAGAAAAGTATCTGTATTCCAGCCATCCACATTAGCAGTTGGT
GTATCCTTTTGGTGCTTTGTTTTTGTCTTGTTTTTATACCCTTGAAAATTATTAATGACTGCAGAGCTTTCTAAGTGGCTTTAATATCAAAACACTCAAAGAACTCTTCCTATTTATGCC
TTTCTGTGCTTTGCAGGTGTTTGTTTTTGGTCCTGATAAGAAGCTGAAGCTGTCCATCCTCTACCCAGCTACCACGGGCAGGAACTTTGATGAGATTCTCAGGGTAGTCATCTCTCTCCA
GCTGACGGCAGAAAAAAGGGTTGCCACCCCAGTTGATTGGAAG
AGGTAAAGATGTTTTTTAAAAAAAAGCAGTTTCTGTACTTGCCTGAAGGGCCAGTCTCTAAAGGGCCAACTTCAAGG
TCTGTGTTACCTGGATCTCTGTGTCTAGCACGCAAGTACACTGGGAGGATTTTTCCTCATGACTGAGTCCAAGATTTGCTCACAGGCCCTTTTCAAGGTTTTATAACTAACACCTTTTAT
GTACAACACAAACTCTCTGTATGGCTTTCTGACTTTTAGATAATTTGGAAAAATTATTGGTCAGAATGATTCCTTTTCCTAATAGAAGGTTTAAAAAACACACACACACTTTTATCTAAC
CCTTCCCTGATGGCACAGTATTTATCGCACAATCTTGATTTGCCATTTCTGTTAAGTCATGGATATAAAAATACTGGTGTATTAATGTCATTAAGTATTTCATTTCTCTTAAGCTTCATT
CTTTTAAACCTGTGCTAGAATTCTCCAAAATTTGTTCATACACTAAGTCTTTAAGACATGGATAACATCACAAGAGTATCTTAACATTGCTACATTTTTAAAATAATGCTAACCTGAATA
CCAGGTTTTGTTTTGGTTTTTTCTGACAGACAAATCACTTAAATTCTGTATCCACTAGTTAATTTAATATTACTGATTTATGTACTTATTGAGCGCAGATAGTAGTGAACTGGGGGGATA
GCAGTGAACAATAGAAGGTCCTTGCCCTCATAGAACTTCCATTCCAGTGAGTGGAGACAAGCAGTAAACAAGTTTATTAAGTGGTAATAGCAGGTGCTACAGGGAAGAATCAAGCACAGA
TGGGGAGAATAACAGTACAGGGGTGGGAGAGTGACTGTCAAGGAATGCCTGTCTCTGAAGGGACTTTTGGGAAGAAAGACACAGAGAAGATGTGACCAAGGCATATGTATTTGTGAGGGA
CGAGCACTACAGGCAGAAGGAGCAGTTAGTGCAAGAAGCTGGGCCTACAAATGAGCTTGGCATGTTGGAGGAATACAAGGAAAGCTAGCATGCCTGGAGCAGAAGCCGCAAAAGGTGGGG
TGAGGGACAAGAGACGAGAGGAGGCAGGATTCCATCACACAGGGCTTGCAGGCCATGATACTCACTTAGAATTAAATGTAAAGTGTGGTGGCCGGCTGTTACTGGGTTTAAAACGGCTGT
TTCTTGTTAATATGGGGTAACTACTTTCCCACCAAAAGTGCCAAAGATCAACTTGGAAAACAAAATCCTCAAAGAGGGGAAGAGTGAAGAACACTTGATTAGTCTCATTAGCACCTGTGG
CTACTTTTCTAAAGTTAATTCATGAAGGCCTTGAAGCTTCACTATGAGACTGAATTTCACCATTCTCAATGTCTTTCAATAGGATGGGGATAGCGTGATGGTCCTTCCAACCATCCCCGA
AGAAGAAGCCAAAAAACTTTTCCCGAAAGGAGTCTTCACCAAAGAGCTCCCATCTGGCAAGAAATATCTCCGCTACACACCCCAGCCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCGGAGGTCTGCTTCTCGGGGACGAGGCTCCCAACTTTGAGGCCAATACCACCGTCGGCCGCATCCGTTTCCACGACTTTCTGGGAGACTCATGGGGCATTCTCTTCTCCCACCCT
CGGGACTTTACCCCAGTGTGCACCACAGAGCTCGGCAGAGCTGCAAAGCTGGCACCAGAATTTGCCAAGAGGAATGTTAAGTTGATTGCCCTTTCAATAGACAGTGTTGAGGACCATCTT
GCCTGGAGCAAG
GATATCAATGCTTACAACTGTGAAGAGCCCACAGAAAAGTTACCTTTTCCCATCATCGATGATAAGAATCGGGACCTTGCCATCCTGTTGGGCATGCTGGATCCAGCA
GAGAAGGATGAAAAGGGCATGCCTGTGACAGCTCGTGTG
GTGTTTGTTTTTGGTCCTGATAAGAAGCTGAAGCTGTCCATCCTCTACCCAGCTACCACGGGCAGGAACTTTGATGAGATT
CTCAGGGTAGTCATCTCTCTCCAGCTGACGGCAGAAAAAAGGGTTGCCACCCCAGTTGATTGGAAG
GATGGGGATAGCGTGATGGTCCTTCCAACCATCCCCGAAGAAGAAGCCAAAAAA
CTTTTCCCGAAAGGAGTCTTCACCAAAGAGCTCCCATCTGGCAAGAAATATCTCCGCTACACACCCCAGCCTTAA

Retrieve as FASTA