1. Browse the Database
  2. View Redoxidase
Entry information : GzCMDn02
Entry ID 4647
Creation 2007-02-14 (Filippo Passardi)
Last sequence changes 2007-02-14 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: GzCMDn02
Name GzCMDn02
Class Carboxymuconolactone decarboxylase (no peroxidase activity)    [Orthogroup: CMDn001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Gibberella
Organism Gibberella zeae (anamorph Fusarium graminearum)    [TaxId: 5518 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GzCMDn02
start..stop		 S start..stop
GzCMDn01 268 5.96e-93 1..184 1..187
NcCMDn 261 2.12e-90 1..185 1..193
CgCMDn 261 3.34e-90 1..175 1..179
AfumCMDn02 207 2.58e-69 1..180 1..184
Gene structure Fichier Exons►


exon

Literature and cross-references GzCMDn02
Literature Birren B. et al.

Direct Submission

Submitted (02-MAY-2003
Protein ref. GenPept:   EAA70355 UniProtKB_Uniparc:   Q4HYB9
DNA ref. JGI genome:   Supercontig_3.7 (621153..620478)
Protein sequence: GzCMDn02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   190
PWM (Da):   %s   21229.8 Transmb domain:   %s   o301-323i444-466o488-510i663-680o
PI (pH):   %s   4.86
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRIPYVSNPPETKTEEHAAIVKRIEERRAPRPLQSLDLALLHSPHVADGWNSFLGAVRTKTSLSDDLRELAISRVAVCNKAWYEWKHHAPLAVKGGVSEAGLEAIKQDTLGERPAELSEK
QWAVILFTDEMTRNVQVEDETFDRLREFFNEQEIVEITATVACYNCVSRFLVALDVGERNGTDPEAVTGH

Retrieve as FASTA  
Remarks Complete sequence rfom Genomic (Chromo 1, 3 exons). Strain="PH-1 / NRRL 31084".
DNA ►
Send to BLAST
CDS►
Send to BLAST