Entry information : CgCMDn
Entry ID 4648
Creation 2007-02-14 (Filippo Passardi)
Last sequence changes 2007-02-14 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-24 (Catherine Mathe (Scipio))
Peroxidase information: CgCMDn
Name CgCMDn
Class Carboxymuconolactone decarboxylase (no peroxidase activity)    [Orthogroup: CMDn001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium
Organism Chaetomium globosum    [TaxId: 38033 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgCMDn
start..stop
S start..stop
GzCMDn02 261 3.57e-90 1..179 1..175
NcCMDn 251 6.73e-86 1..179 1..183
GzCMDn01 248 1.12e-84 1..179 1..178
AfumCMDn02 195 3.79e-64 1..179 1..179
Gene structure Fichier Exons


exon

Literature and cross-references CgCMDn
Literature Birren B. et al.

The Broad Institute Genome Sequencing Platform

Annotation of the Chaetomium globosum CBS 148.51 Genome

Unpublished (2004)
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=full_report&list_uids=4388041
Protein ref. GenPept:   EAQ92279 UniProtKB:   Q2HGZ0
DNA ref. JGI genome:   scaffold_1 (1541522..1542356)
Protein sequence: CgCMDn
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   203
PWM (Da):   %s   22300.41 Transmb domain:   %s   o410-429i
PI (pH):   %s   4.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRIPYVPNPPEPSSAEEAAIVSRIQARRAPRPLQPLDLALLHAPAVADGWNSFLGAVRTRTGLAADLREIAISRVAVVNRAWYEWAHHAPLAEQGGVSKLGMEAVRREEELRLEDPVPEG
LTAQQWAVVCYAEEMTRNVQVRDETFAKLREMFGEKEIVEITAT
VACYNCVSRFLVALDDSALEIQIGLMASSTQDRPAPNAA

Retrieve as FASTA  
Remarks Complete sequence from Genomic. Strain="CBS 148.51". 3 exons.
DNA
Send to BLAST
CDS
Send to BLAST