Entry information : MgrPrxII
Entry ID 4681
Creation 2007-02-16 (Christophe Dunand)
Last sequence changes 2007-02-16 (Christophe Dunand)
Sequence status complete
Reviewer Filippo Passardi
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: MgrPrxII
Name MgrPrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Magnaporthaceae Magnaporthe
Organism Magnaporthe grisea (Pyricularia grisea)    [TaxId: 148305 ]
Cellular localisation N/D
Tissue types Conidia
Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MgrPrxII
start..stop
S start..stop
VdaPrxII01 216 4.72e-73 3..168 2..166
NcPrxII-B 203 3.88e-68 1..168 1..166
CgPrxII_CBS14851 201 1.98e-67 1..168 1..166
CgPrxII 200 5.55e-67 1..168 1..166
Gene structure Fichier Exons


exon

Literature and cross-references MgrPrxII
Literature Thon M.R., Pan H., Diener A., Papalas J., Taro A., Mitchell T., Dean R.A. The sequence of Magnaporthe grisea chromosome 7.
Protein ref. UniProtKB_Uniparc:   Q2KG80
DNA ref. JGI genome:   Supercontig_6.23 (1396689..1396031)
mRNA ref. GenBank:   XM_366634
Cluster/Prediction ref. UniGene:   Mgr.6259
Protein sequence: MgrPrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168 (304)
PWM (Da):   %s   17880.02 (32593.4)  
PI (pH):   %s   5.27 (7.99) Peptide Signal:   %s   cut: 27 range:27-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALKVGDAFPDGVSFTYVPTGGKKEDVTACGNGIKYNASTEAKDKKIVIVSVPGAFTPTCQEQHLKSYVEKKDELKAKGVDKVVFIAYNDHWVMSAWGKANDIYDDFIIFASDDGISFSKSIGWNLGDSGRTARYAIVVDHGKVTYAEKEEAGGIAVSGA
EAVLAKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo VII, 3 exons), 1 mRNA and 76 ESTs. Strain="70-15". Homologous to PrxII with only one Cystein.
DNA
Send to BLAST
CDS
Send to BLAST