Entry information : GmPrx01 (SPOD4.1 / Glyma09g02590.1 / SBP)
Entry ID 475
Creation 2006-08-28 (Christophe Dunand)
Last sequence changes 2011-12-14 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-01-11 (Christophe Dunand)
Peroxidase information: GmPrx01 (SPOD4.1 / Glyma09g02590.1 / SBP)
Name (synonym) GmPrx01 (SPOD4.1 / Glyma09g02590.1 / SBP)
Class Class III peroxidase    [Orthogroup: Prx193]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Floral meristems
Seed coats
Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx01
start..stop
S start..stop
MtPrx111 548 0 1..342 1..338
MtPrx30 541 0 1..343 1..340
PvPrx01 495 2e-177 24..345 20..341
GmPrx69 484 3e-173 24..349 20..345
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1770847..1771065 219 N° 2 1771697..1771888 192 N° 3 1772919..1773084 166 N° 4 1773348..1773829 482
join(1770847..1771065,1771697..1771888,1772919..1773084,1773348..1773829)


exon

Literature and cross-references GmPrx01 (SPOD4.1 / Glyma09g02590.1 / SBP)
Literature Gijzen,M. The soybean Ep locus encodes the abundant seed coat peroxidase enzyme.
Protein ref. UniProtKB:   O22443
DNA ref. Phytozome 12:   Gm09 (1770847..1773829)
Omic ref. e-FP Browser:   Glyma09g02590
Protein sequence: GmPrx01 (SPOD4.1 / Glyma09g02590.1 / SBP)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   352 (326)
PWM (Da):   %s   37953.86 (35227.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.68 (4.50) Peptide Signal:   %s   cut: 27 range:27-352
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSMRLLVVALLCAFAMHAGFSVSYAQLTPTFYRETCPNLFPIVFGVIFDASFTDPRIGASLMRLHFHDCFVQGCDGSVLLNNTDTIESEQDALPNINSIRGLDVVNDIKTAVENSCPDTVSCADILAIAAEIASVLGGGPGWPVPLGRRDSLTANRTLANQNLPAPFFNLTQLKASFAVQGLNTLDLVTLSGGHTFGRARCSTFINRLYNFSNTGNPDPTLNTTYLEVLRARCPQNATGDNLTNLDLSTPDQFDNRYYSNLLQLNGLLQSDQELFSTPGADTIPIVNSFSSNQNTFFSNFRVSMIKMGNIGVLTGDEGEIRLQCNFVNGDSFGLASVASKDAKQKLVAQSK

Retrieve as FASTA  
Remarks complete sequence from genomic and 46 ESTs and 1 mRNA. Cultivar="Harosoy 63".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCCATGCGTCTATTAGTAGTGGCATTGTTGTGTGCATTTGCTATGCATGCAGGTTTTTCAGTCTCTTATGCTCAGCTTACTCCTACGTTCTACAGAGAAACATGTCCAAATCTG
TTCCCTATTGTGTTTGGAGTAATCTTCGATGCTTCTTTCACCGATCCCCGAATCGGGGCCAGTCTCATGAGGCTTCATTTTCATGATTGCTTTGTTCAA
GTACGTACTTTTTTTTTTCCT
TCCAAAATGCCCTGCATATTTAACAAGATTGCTTTGTTCACCTAGAAAAATGTGTTTTTTTCAACGATCTTACGTACGTTTGTTTGGTTTGAAAAATAAATCAGAAAGAGATCAAGAAAA
TAGCTAGAAAGAAAGCAACGTTTTTTTAAAAGGTATTTAGTGTGAGAAAAATATTAAAACTGAAGAGAAAGAAATTAAATAAGCTTTTCTTGAATGATATTTACATGTCTTATTAACTTA
AAGTCACCTTTTTTCTTTAAGTTGTGCTTGAAGAAAAAAGATGTCTTTCAGTTTAGTTTTGATTAATNNNNNNNNNNNNNNNNNNNNNNNNNTTAATACTATATATCTATTTACCATATT
AATTATTACTATATTTCATGATGACAACAGACAAGTATTCTAAAGAGGTATCGGTAGATGATTAATTTTTTTATAAAAAAATCTTTTGCGTGTATAGATATTCTTTTATAATTGGTGCAG
AAACTTGTAATGCTAATTGCAATTAATCTTACATTGATTAACTAATAGCTATAATCAATATTTAGGTTAGGTATAGGAGACAAATCAAGTGATCTGAACAAATTAAGTTGTTATATTTGC
ATTGTGACAGGGTTGTGATGGATCAGTTTTGCTGAACAACACTGATACAATAGAAAGCGAGCAAGATGCACTTCCAAATATCAACTCAATAAGAGGATTGGACGTTGTCAATGACATCAA
GACAGCGGTGGAAAATAGTTGTCCAGACACAGTTTCTTGTGCTGATATTCTTGCTATTGCAGCTGAAATAGCTTCTGTTCTG
GTAATTAATAACTCCTAATTAATTCCCAGCCATTAAAA
GTTGCATGATTGGATTCAAAATTCTATGGTATTGGGGTTCTGATATAAATTTGTAATTAAATTGCACTAAAAAAAATTATCATATACTTTTAATAAAATTTTTTTATCTAATTTAATTTA
TTATTAAAACTATTTTTAAAATTCAATCCTAACTCTTTTTTAATCGGAGCATGTAAGCTGGCACCCACCGTATATCGTTGGAAGATGCTATAAAACCATTTAATTAATGGATGGAATCAG
TCAAAACATTTAATTCAAAATACTCTTAATTGTGATTAGTAATCATGTTCGGGCAAGTTACGTTGTGTATAATTAATTTGACTTAATCAGATAAAAAAACAAATGGACGCAAGCCGGTTG
GTATAGATATCACTGGCCTGTAGAATATGTGGTTTTTCACGTTTAAATAAAAGCTAGCTACTATATTATATTTAGTCTTTTTTTTTTCTTAAACCCATTTAACGTGATTTATTGACTGTG
AAACATGTTTCCACACACAGGCTTAGAAACTCCTCGCAACTAACATCTCCAAAATTTGACTATTTATTTATGAAGATAATTCATCTATGATGTTCAACTCTATTATATATATGTATCATC
GCAGTATTAAGAATTATAATAGTCAAATATAGAAGTATATCGGGTAAATGTAGTTGCATGTGCGACCTGTTTCGTGTAAAATGCTTATTCTATATAGCTTTTTTTATTGGAAAATAACAA
TGAACTAAAAACGAAAGAGTATCATATAGTTTGACTTTTATGTTAGAGAGAGACATCTTAATTTGGTCATATGTTAAATAATTAATTACAATGCATACACAAATATTTATGCCATATCTA
AAAAATGATAAAATATCATAGGTATACTCAACTATATGATATCCCCATAACAGAAATTGTACTTTTCTTCAGGCAAAGAACTTAACATTTCTGTTTGCTAAAAACAAACATCCACTTAAA
GTGGTTCAACATATTTATGTAATAATTTACAGGGAGGAGGTCCAGGATGGCCAGTTCCATTAGGAAGAAGGGACAGCTTAACAGCAAACCGAACCCTTGCAAATCAAAACCTTCCAGCAC
CTTTCTTCAACCTCACTCAACTTAAAGCTTCCTTTGCTGTTCAAGGTCTCAACACCCTTGATTTAGTTACACTCTCAG
GTATACATAATCAATTTTTTATTTGCTATTAGCTAGCAATAA
AAAGTCTCTGATACAGACATATTTAGATAAATTAATTTCTCCATAAACATTTATAATAAAATTATCAATTTATGTACTTAAAAATTATGGATTGAAGCTCTTTTCATCCAACTTTTACTA
AAGTTAAGGTGCATATAATATAAAATAAACTATCTCTTGTTTCTTATAAAAAGATTGAAGATAAGTTAAAGTCTACTTATAAATCATTAATATATGTATAGGTGGTCATACGTTTGGAAG
AGCTCGGTGCAGTACATTCATAAACCGATTATACAACTTCAGCAACACTGGAAACCCTGATCCAACTCTGAACACAACATACTTAGAAGTATTGCGTGCAAGATGCCCCCAGAATGCAAC
TGGGGATAACCTCACCAATTTGGACCTGAGCACACCTGATCAATTTGACAACAGATACTACTCCAATCTTCTGCAGCTCAATGGCTTACTTCAGAGTGACCAAGAACTTTTCTCCACTCC
TGGTGCTGATACCATTCCCATTGTCAATAGCTTCAGCAGTAACCAGAATACTTTCTTTTCCAACTTTAGAGTTTCAATGATAAAAATGGGTAATATTGGAGTGCTGACTGGGGATGAAGG
AGAAATTCGCTTGCAATGTAATTTTGTGAATGGAGACTCGTTTGGATTAGCTAGTGTGGCGTCCAAAGATGCTAAACAAAAGCTTGTTGCTCAATCTAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCCATGCGTCTATTAGTAGTGGCATTGTTGTGTGCATTTGCTATGCATGCAGGTTTTTCAGTCTCTTATGCTCAGCTTACTCCTACGTTCTACAGAGAAACATGTCCAAATCTG
TTCCCTATTGTGTTTGGAGTAATCTTCGATGCTTCTTTCACCGATCCCCGAATCGGGGCCAGTCTCATGAGGCTTCATTTTCATGATTGCTTTGTTCAA
GGTTGTGATGGATCAGTTTTG
CTGAACAACACTGATACAATAGAAAGCGAGCAAGATGCACTTCCAAATATCAACTCAATAAGAGGATTGGACGTTGTCAATGACATCAAGACAGCGGTGGAAAATAGTTGTCCAGACACA
GTTTCTTGTGCTGATATTCTTGCTATTGCAGCTGAAATAGCTTCTGTTCTG
GGAGGAGGTCCAGGATGGCCAGTTCCATTAGGAAGAAGGGACAGCTTAACAGCAAACCGAACCCTTGCA
AATCAAAACCTTCCAGCACCTTTCTTCAACCTCACTCAACTTAAAGCTTCCTTTGCTGTTCAAGGTCTCAACACCCTTGATTTAGTTACACTCTCAG
GTGGTCATACGTTTGGAAGAGCT
CGGTGCAGTACATTCATAAACCGATTATACAACTTCAGCAACACTGGAAACCCTGATCCAACTCTGAACACAACATACTTAGAAGTATTGCGTGCAAGATGCCCCCAGAATGCAACTGGG
GATAACCTCACCAATTTGGACCTGAGCACACCTGATCAATTTGACAACAGATACTACTCCAATCTTCTGCAGCTCAATGGCTTACTTCAGAGTGACCAAGAACTTTTCTCCACTCCTGGT
GCTGATACCATTCCCATTGTCAATAGCTTCAGCAGTAACCAGAATACTTTCTTTTCCAACTTTAGAGTTTCAATGATAAAAATGGGTAATATTGGAGTGCTGACTGGGGATGAAGGAGAA
ATTCGCTTGCAATGTAATTTTGTGAATGGAGACTCGTTTGGATTAGCTAGTGTGGCGTCCAAAGATGCTAAACAAAAGCTTGTTGCTCAATCTAAATAA

Retrieve as FASTA