Entry information : GmPrx[P]12
Entry ID 486
Creation 2005-09-26 (Christophe Dunand)
Last sequence changes 2012-05-07 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Christophe Dunand)
Peroxidase information: GmPrx[P]12
Name GmPrx[P]12
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type Roots
Inducers Cyst nematode infection
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]12
start..stop
S start..stop
GmPrx12 219 5e-73 1..124 1..129
GmPrx86 213 1e-70 1..124 3..131
GmPrx11 212 4e-70 1..124 3..131
GmPrx55 208 9e-69 1..124 3..131
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 39195521..39195712 192 N° 2 39195223..39195420 198  
complement(join(39195223..39195420,39195521..39195712))


exon

Literature and cross-references GmPrx[P]12
Literature Wang,G., et al. Transcriptionally regulated genes of early response to soybean cyst nematode's infection in resistant soybean PI 437654.
DNA ref. Phytozome 12:   Gm15 (39195707..39195223)
Protein sequence: GmPrx[P]12
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   128 (112)
PWM (Da):   %s   13578.05 (11992.3)  
PI (pH):   %s   7.59 (7.11) Peptide Signal:   %s   cut: 17 range:17-128
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSNLRFLSLxASTHAQL*LGFYVNSCPKIEQIVLKFVHDHIHNAPSLAAALIRMHFHDCFVRGCDASALLNSTTNQVEKNARPNLTVRGFDFIGIIKSLVEAECHGVVS*ADILTLVAKDTIVxATVST

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic (Large 3' is missing which can not be found and sop codon in frame). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGCAACTTGAGGTTTTTGAGTCTTTNNGCATCAACTCATGCTCAACTTTAGCTTGGTTTTTATGTTAACAGTTGCCCAAAAATAGAGCAAATTGTTTTGAAATTTGTTCATGAC
CATATCCATAATGCTCCATCACTAGCAGCTGCATTAATAAGAATGCACTTTCATGACTGTTTTGTAAGGGTA
TGTGCTTCAATCTTTAAGCTTCTTTCATTTTTACTTAACAAGTACAAT
GTTATTGTTAGATTAAGGTTAAGGAGCTAACTAAGATGAAGCATTTCAGGGATGTGATGCATCAGCCCTTTTGAACTCAACAACCAATCAGGTTGAGAAGAATGCTCGTCCAAATCTTAC
AGTAAGAGGCTTTGACTTCATTGGCATTATAAAGAGCCTTGTTGAAGCTGAATGCCATGGTGTGGTCTCTTGAGCTGATATCCTCACTTTGGTTGCCAAAGACACTATTGTTNNNGCAAC
AGTAAGTACT

Retrieve as FASTA