Entry information : GmPrx22 (Glyma14g05850.1)
Entry ID 492
Creation 2005-11-09 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx22 (Glyma14g05850.1)
Name (synonym) GmPrx22 (Glyma14g05850.1)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Roots
Seedlings
Stems
Inducer Salicylic acid treatment
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx22
start..stop
S start..stop
LjPrx15 537 0 1..314 1..316
MtPrx34 510 0 1..314 1..318
MtPrx37 501 0 1..314 1..320
GmPrx123 499 3e-180 1..314 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4231699..4231899 201 N° 2 4232200..4232391 192 N° 3 4232511..4232676 166 N° 4 4234246..4234631 386
join(4231699..4231899,4232200..4232391,4232511..4232676,4234246..4234631)


exon

Literature and cross-references GmPrx22 (Glyma14g05850.1)
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm14 (4231699..4234631)
Protein sequence: GmPrx22 (Glyma14g05850.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314 (295)
PWM (Da):   %s   34004.07 (31932.0)  
PI (pH):   %s   7.67 (7.68) Peptide Signal:   %s   cut: 20 range:20-314
Sequence 356
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASYYFLLLVLVGATTASGAELCADFYSCTCPNLLPIVKKGVAKAIQKEPRMGASLLRLHFHDCFVNGCDASILLDDTSNFIGEQTAAANNQSARGFNVINDIKASVEKECPRVVSCADILALSARDSVVYLGGPSWEVGLGRRDSTTASRSDANNSIPGPFLSLTALINNFANQGLSVTDLVALSGAHTIGLAECKNFRAHIYNDSNVDPSYRKFLQSKCPRSGNDKTLEPLDHQTPIHFDNLYFQNLVSKKALLHSDQELFNGSSTDNLVRKYATNAAAFFEDFAKGMLKMSNIKPLTGSQGQIRINCGKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 14 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTCTTACTACTTCCTCTTGCTTGTTCTCGTCGGTGCAACTACAGCTTCTGGGGCTGAACTATGTGCAGACTTTTACTCATGCACCTGCCCAAACTTGTTGCCTATAGTGAAGAAAG
GAGTGGCCAAAGCCATTCAGAAAGAACCACGCATGGGCGCTTCCTTACTCCGATTGCATTTCCATGACTGCTTTGTAAAC
GTGAGTATATAATTAATAATGTAGTTGAATTAATATGACA
TACATTTTATGTTTACATCATGTAACCTTTTTTGTATAGGTTGCAAGTTGCGAGAAACTATTACATTGTCTGGCTCATTATGATCCAAATAATCTTCACATGACACGTAATTAAGTGTTA
AGTGTTATTAGTTTTTTTAAAATTAAACAAAAAATTGAATGCATGTCACCTAGAAATTGATTGAAACTATAAACATGTAGTGGTCTGAAACTATCTAATAAATTCCTCCAAGTTGCTTTC
CTAAGATAGTGATATTTCAGGGTTGTGATGCATCTATACTGTTGGATGATACAAGCAACTTCATTGGGGAGCAAACAGCAGCAGCTAACAACCAATCAGCTAGAGGGTTCAACGTGATTA
ATGATATTAAGGCCAGTGTGGAGAAAGAATGCCCCAGAGTAGTGTCATGTGCTGATATTCTTGCTTTGTCAGCTAGAGATTCTGTAGTTTAT
GTAATAATACTATACTAATATTCTGAGA
TTCTATTTCTATCCCAGTCAAAGTTATCAATTATTATGGCCCTTGAATTAATAGCACTTACTATATATCTTTTTGTGTAAAACATTTTCAGTTAGGAGGACCTTCTTGGGAAGTGGGGTT
GGGGAGAAGAGATTCTACTACAGCAAGCAGAAGTGATGCTAATAATAGCATTCCTGGGCCTTTCCTCAGTCTAACTGCTCTGATAAACAATTTTGCTAATCAAGGCCTCTCAGTTACAGA
TTTGGTGGCTCTTTCAG
GTGCTATAACAATTTATGAGATGTCTTGAATCAGTTAAAACAAATGCTTTCCAAAAAGAGAAGACTTCCACAAAAATAAGTTAAAATAAATGTTTTTTAACAC
GTTTGGCTTCCAAATTAAAGTTGTGATTTTATATGTGTAGTGATTGTGATCAATGGCGGATTGAGGGGATCTAGGTTCATTTGAGGGAGTGCACTTGCACCTCCTCATTTTTTAAAATTT
ATCAAATTTGTAAATAAATTTTTATATTTTTGTATTTTATTTTATCTATATTTATATAATTGAACCTTCTAATTTTATTTTTTATAATTTGTAGCCACTAACTTAAGGTCTTGGATTCAC
CACTTATTACGATGACATGTGCAGTTTGTTGCATTAGTAATTTAATTATTTGACTAAATAATCCCTATTAAATAGAATTTGCCAGAGATGAACTCATAATAAAAAAATTGAGGAAATTGT
TCTTTCTTTTCATTTTAACTAAATGAATAGAAGTGATATTAAAAAAATTAATAAATGCAATGACAAAAAAATGATAAATATTATTCGTCAATTTTTCAATTATTAAAAATAAGGTGGCTG
AAATTAAATAAAAATTGATAAATAGTCCGTTTCATTGAGCTTAAAGAAAGTAAATTTGTGATTCGGCCTTTCCAGAGCTTTTTCCATAAACTAATTCTTTTCACTTTTAAGAAAAATACT
AAAATATTTTTTACTTTTCATTTTTAAAAAATTAAAACTTACATAATTATTATAATTTTTTTGAACATATCTATAATTAAAAACTCACTTTTCACTTTTAATTATTTTATTTCATGCAAT
CCAACAAAAACTCATTGTTTACTCATCTGCTTTCCATTGAGGTATGAAATTTGAACCGATTAATTATTTATTACTTTTCTTATTATTCCGTTTAGTTTACTTCTTAAATAATGTGATAAA
AATTTCTTCCTAAACATAAAATATAAATAATCAAGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCAAATATCCCATCGTATT
GATCTAGGTGTCTTTATTTGTTTCTACAAGTCAACGGATTCTAGTACTCTTAAGTCTTGGTTGTTGAGTGAGTAACAAAACAATCCTTTTATCAAGGGAATCTAACTAGATGATTGAGTG
AGTTATTGGAGACTATTACCTGTAAAAAAAATAAAATCTTTTCGCGGTTATTGTCATGATTAAGAGTGGTGTCCTATTCCTATCTATCTATTATCTAAAACCATCACTCGTCAGTTTGAG
TTTTGCTCAACCTATATATTGCCAAAAGAAATTACCACTTTGTTGTTCAAAAGTTGTGCTAGGAAAAATATTTTAGTGAATTTGGTCATTTCATTTTTTTCTGGAGAATAAATAATAATA
CCTTCCATTTCCTGCACTGAATTGTGTTTTCCTCTGCCTTTGTAAAAAAACTGTCGTACTAAAGAAATAAGAGGATCCTAATTGAATTTTGGCTTCCCATATTCACAAAGTGCTTCAACT
ACCTAACAGCATCTTTTCAATAACAGGGGCACATACAATTGGCCTGGCTGAATGCAAAAATTTCCGAGCACACATCTACAATGATTCCAACGTTGATCCCTCTTACCGAAAGTTCCTGCA
GAGCAAGTGCCCCAGAAGTGGAAATGATAAAACACTCGAACCCCTTGACCACCAAACTCCAATCCATTTTGATAATCTATACTTTCAGAATTTGGTGAGTAAGAAGGCCCTTCTCCATTC
CGATCAGGAGCTGTTCAATGGCAGTTCTACTGACAATCTGGTAAGAAAATATGCTACCAATGCTGCTGCATTCTTTGAAGACTTTGCCAAGGGCATGCTCAAAATGAGCAACATCAAGCC
TCTTACAGGAAGCCAGGGCCAGATCAGAATCAATTGTGGGAAAGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTCTTACTACTTCCTCTTGCTTGTTCTCGTCGGTGCAACTACAGCTTCTGGGGCTGAACTATGTGCAGACTTTTACTCATGCACCTGCCCAAACTTGTTGCCTATAGTGAAGAAAG
GAGTGGCCAAAGCCATTCAGAAAGAACCACGCATGGGCGCTTCCTTACTCCGATTGCATTTCCATGACTGCTTTGTAAAC
GGTTGTGATGCATCTATACTGTTGGATGATACAAGCAACT
TCATTGGGGAGCAAACAGCAGCAGCTAACAACCAATCAGCTAGAGGGTTCAACGTGATTAATGATATTAAGGCCAGTGTGGAGAAAGAATGCCCCAGAGTAGTGTCATGTGCTGATATTC
TTGCTTTGTCAGCTAGAGATTCTGTAGTTTAT
TTAGGAGGACCTTCTTGGGAAGTGGGGTTGGGGAGAAGAGATTCTACTACAGCAAGCAGAAGTGATGCTAATAATAGCATTCCTGGGC
CTTTCCTCAGTCTAACTGCTCTGATAAACAATTTTGCTAATCAAGGCCTCTCAGTTACAGATTTGGTGGCTCTTTCAG
GGGCACATACAATTGGCCTGGCTGAATGCAAAAATTTCCGAG
CACACATCTACAATGATTCCAACGTTGATCCCTCTTACCGAAAGTTCCTGCAGAGCAAGTGCCCCAGAAGTGGAAATGATAAAACACTCGAACCCCTTGACCACCAAACTCCAATCCATT
TTGATAATCTATACTTTCAGAATTTGGTGAGTAAGAAGGCCCTTCTCCATTCCGATCAGGAGCTGTTCAATGGCAGTTCTACTGACAATCTGGTAAGAAAATATGCTACCAATGCTGCTG
CATTCTTTGAAGACTTTGCCAAGGGCATGCTCAAAATGAGCAACATCAAGCCTCTTACAGGAAGCCAGGGCCAGATCAGAATCAATTGTGGGAAAGTCAATTAA

Retrieve as FASTA