Entry information : Tn1CysPrx (PrxVI)
Entry ID 4953
Creation 2007-03-11 (Nicolas Rouhier)
Last sequence changes 2016-06-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-28 (Christophe Dunand)
Peroxidase information: Tn1CysPrx (PrxVI)
Name (synonym) Tn1CysPrx (PrxVI)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Tetraodontidae Tetraodon
Organism Tetraodon nigroviridis    [TaxId: 99883 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Tn1CysPrx
start..stop
S start..stop
Pret1CysPrx01 359 1.58e-127 1..226 1..224
Pret1CysPrx02 340 1.13e-120 1..223 1..219
Ipu1CysPrx 340 2.21e-120 1..226 1..223
Gga1CysPrx 338 1.05e-119 1..226 1..223
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '4953' 'join(1..92,467..623,696..851,944..1090,1173..1301)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..92 90 N° 2 467..623 155 N° 3 696..851 154 N° 4 944..1090 145
N° 5 1173..1301 127  
join(1..92,467..623,696..851,944..1090,1173..1301)


exon

Literature and cross-references Tn1CysPrx (PrxVI)
Literature Jaillon O., A et al. Genome duplication in the teleost fish Tetraodon nigroviridis reveals the early vertebrate proto-karyotype. Nature 431:946-957(2004).
Protein ref. UniProtKB:   Q4SP21 [Incorrect splicing]
DNA ref. GenBank:   CAAE01014542 (485072..483772)
mRNA ref. GenBank:   CAF97611 [Incorrect splicing]
Protein sequence: Tn1CysPrx (PrxVI)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   226
PWM (Da):   %s   24712.48  
PI (pH):   %s   4.75
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLLLGEVFPDFRAETTTGTISFHQFLGDSWAILFSHPGDYTPVCTTELGRAARLSGEFSKRRVKMVALSVNSLEDHQGWTDILAYNGEDGESGELPFPIIADANRELAVALGMLDPEE
KDKDGMPLTARCAS
VFIIGPDKRLKLSLLYPATTGRNFDEILRVVDSLQLTAAKRVATPADWKPGECVMVPPSMSEEEAAAMFPEGIYSKELPSGKKYLRYTPQP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 15, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGGCTGCTGCTCGGAGAAGTCTTCCCTGACTTCAGGGCTGAAACCACGACTGGCACCATCAGCTTTCACCAATTCCTGGGCGATTCTCGTAAGTTGTGTCCTTGGGAATAAATG
TTTGCAATCGCTGGTTCAACGAATGACTTAAGTTCCGTGATAGAAGCTGTGCGTGATTTCCCACTTCTGCTTTGGCAACTAACACCAGTCTAAGCGGCATCCTGCTCTGCCAGCGCGCTA
TTACTTTATTTATTATTTTACCTGCTGCGATATCCGTGAAAATTGGGAATTTGGGTAGCTTTTAGGGACTCATGATCCTATTTAAGATAATCAGGCATTTATTATAGTGTTTAGAGCGAA
GCTATTTTTACCAAACACCCGGAAGTCCCCCTCCACGAGGTGTGAAAAGCAGCGCGTCTGCTCCACAGCAGCAAGAGGTCAACCGCAGCCTCCTTCTCTTTCTTCCAGGTGGGCGATCCT
GTTCTCCCACCCCGGAGACTACACCCCTGTCTGCACCACAGAGCTGGGCCGAGCTGCACGGCTGAGCGGCGAGTTCAGCAAACGGCGGGTCAAAATGGTCGCCCTGTCCGTCAACAGCCT
GGAGGACCACCAGGGCTGGACCAAG
AGGTCTGGAGGGAAACCCATCGGGCTGTGACAGCTGGACATATGTGCATGTGTGCGCGTCTCTCTGCTCACCAGGACATCCTGGCGTACAACGGA
GAGGACGGCGAGAGCGGCGAGCTGCCCTTCCCCATCATAGCGGACGCTAACCGGGAGCTGGCAGTGGCCCTGGGCATGCTGGACCCGGAGGAGAAGGACAAGGACGGGATGCCGCTCACA
GCCCGCTGTGCAAGT
GTGTCCACATCAAGCCCCTGTGGTCTTTTTTAGGGATACCGGTCCATCCAAAGGTGCACGGAATCCAATCCCTCCACCTCTGCTCTGCGTTTAGGTGTTCATCAT
CGGTCCCGACAAGAGGCTGAAGCTGTCGCTGCTCTATCCCGCCACCACCGGGCGCAACTTTGACGAGATCCTACGAGTGGTGGACTCTCTCCAGCTCACAGCCGCCAAACGAGTGGCCAC
CCCAGCCGACTGGAAG
AGGTACGTCCCGCCTCCTCCGACGGGCTTCGGGTTTCCCCGGCAACCACCTGACTCCGTTTCCCCGGCGCCTGTCTGCTCCCAGCCTGGAGAGTGTGTGATGGT
TCCTCCCAGCATGTCTGAGGAGGAAGCTGCCGCCATGTTCCCTGAAGGCATCTACAGCAAAGAGCTGCCCTCAGGTAAGAAGTACCTGCGCTACACACCCCAGCCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGGCTGCTGCTCGGAGAAGTCTTCCCTGACTTCAGGGCTGAAACCACGACTGGCACCATCAGCTTTCACCAATTCCTGGGCGATTCGTGGGCGATCCTGTTCTCCCACCCCGGA
GACTACACCCCTGTCTGCACCACAGAGCTGGGCCGAGCTGCACGGCTGAGCGGCGAGTTCAGCAAACGGCGGGTCAAAATGGTCGCCCTGTCCGTCAACAGCCTGGAGGACCACCAGGGC
TGGACCAAG
GACATCCTGGCGTACAACGGAGAGGACGGCGAGAGCGGCGAGCTGCCCTTCCCCATCATAGCGGACGCTAACCGGGAGCTGGCAGTGGCCCTGGGCATGCTGGACCCGGAG
GAGAAGGACAAGGACGGGATGCCGCTCACAGCCCGCTGTGCAAGT
GTGTTCATCATCGGTCCCGACAAGAGGCTGAAGCTGTCGCTGCTCTATCCCGCCACCACCGGGCGCAACTTTGAC
GAGATCCTACGAGTGGTGGACTCTCTCCAGCTCACAGCCGCCAAACGAGTGGCCACCCCAGCCGACTGGAAG
CCTGGAGAGTGTGTGATGGTTCCTCCCAGCATGTCTGAGGAGGAAGCT
GCCGCCATGTTCCCTGAAGGCATCTACAGCAAAGAGCTGCCCTCAGGTAAGAAGTACCTGCGCTACACACCCCAGCCCTGA

Retrieve as FASTA