Entry information : Ha1CysPrx (HanXRQChr07g0194341)
Entry ID 4955
Creation 2010-05-26 (Christophe Dunand)
Last sequence changes 2016-05-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: Ha1CysPrx (HanXRQChr07g0194341)
Name (synonym) Ha1CysPrx (HanXRQChr07g0194341)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ha1CysPrx
start..stop
S start..stop
Le1CysPrx01 386 9.32e-139 1..219 1..219
Vv1CysPrx 385 2.88e-138 1..219 1..219
Nt1CysPrx01 375 1.69e-134 1..219 1..216
Egu1CysPrx03 366 5.82e-131 1..219 1..219
Gene structure Fichier Exons


exon

Literature and cross-references Ha1CysPrx (HanXRQChr07g0194341)
Literature Liu,A. and Burke,J.M. Patterns of Nucleotide Diversity in Wild and Cultivated Sunflower. Unpublished. Submitted (20-APR-2006)
Protein ref. UniProtKB:   Q15CL7
DNA ref. HanXRQ genome:   HanXRQChr07 (58053175..58052280)
Cluster/Prediction ref. UniGene:   Han.2357
Protein sequence: Ha1CysPrx (HanXRQChr07g0194341)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   219
PWM (Da):   %s   24039.29  
PI (pH):   %s   6.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLTIGDSLPNLQVDTTHGKINLHDYVGDSFTIIFSHPGDFTPVCTTELGAMAAYADKFAQRGVKLLGLSCDDVQSHKEWIKDIEAYKGKKVTYPIAADPNREIIKQLNMVDPDEKDAS
GQNLPSRALHIVGPDKK
IKLSFLYPASTGRNMDEVVRALDSLIKASQHKIATPVNWKEGEPVVIAPSVSNDEARKMFPKGFQTVDLPSNKDYLRFTSV*

Retrieve as FASTA  
Remarks Complete sequence from Genomic (3 introns) and 25 ESTs. Isolate="HIDATSA1" and "HIDATSA2", cultivar="RHA801". "A" added at position 16 of cDNA (based on other homologs).
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST