Entry information : Um1CysPrx
Entry ID 4962
Creation 2007-03-11 (Nicolas Rouhier)
Last sequence changes 2007-03-11 (Nicolas Rouhier)
Sequence status complete
Reviewer Filippo Passardi
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: Um1CysPrx
Name Um1CysPrx
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Ustilaginomycetes Ustilaginaceae Ustilago
Organism Ustilago maydis    [TaxId: 5270 ]
Cellular localisation N/D
Tissue type Germinating teliospore
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Um1CysPrx
start..stop
S start..stop
Sre1CysPrx 439 8.43e-160 1..221 1..221
Gin1CysPrx01 333 6.04e-118 4..216 3..215
Tcam1CysPrx 320 1.74e-112 1..201 1..206
Amus1CysPrx 317 1.47e-111 1..213 1..217
Gene structure Fichier Exons


exon

Literature and cross-references Um1CysPrx
Literature REFERENCE 1 Kamper J. et al. Insights from the genome of the biotrophic fungal plant pathogen Ustilago maydis. Nature 444 (7115), 97-101 (2006).
REFERENCE 2 Sacadura,N.T. and Saville,B.J. Gene expression and EST analyses of Ustilago maydis germinating teliospores. Fungal Genet. Biol. 40 (1), 47-64 (2003).
Protein ref. UniProtKB:   Q4P0F9
DNA ref. JGI genome:   contig_1_248 (3152..3898)
EST ref. GenBank:   CD488576.1 [5' end]  EC043850.1 [3' end]
Protein sequence: Um1CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221 (309)
PWM (Da):   %s   24587.67 (33622.9)  
PI (pH):   %s   5.96 (9.48) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLRLGSIAPNFTAETTHGVLNFHEYLGDSWGILFSHPDDFTPV
CTTELGEVARKAPEFEKRGVKIIGLSANDIASHDRWIKDINEVGNTSVNFPIIGDKDRKVSTEYDMLDALDPTNVDAKGIPFTVRDVFVIDPK
KVIRLKISYPASTGRHFDEILRV
IDSLQIGDKYRVTTPVNWQKGDKVIVHPSVQGEEAEKLFPGYETVKPYLRFTKDPSTSSA

Retrieve as FASTA  
Remarks Genomic (chromo 23, 1 intron) and 29 ESTs. Strain="521".
DNA
Send to BLAST
CDS
Send to BLAST