1. Browse the Database
  2. View Redoxidase
Entry information : Ptro1CysPrx01 (Prx VI)
Entry ID 4970
Creation 2009-01-29 (Christophe Dunand)
Last sequence changes 2010-11-08 (Myriam Duval)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-11-08 (Myriam Duval)
Peroxidase information: Ptro1CysPrx01 (Prx VI)
Name (synonym) Ptro1CysPrx01 (Prx VI)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Pan
Organism Pan troglodytes (chimpanzee)    [TaxId: 9598 ]
Cellular localisation N/D
Tissue type Brain
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ptro1CysPrx01
start..stop		 S start..stop
Ptro1CysPrx01-2 456 3.32e-166 1..224 1..224
Pabe1CysPrx01 456 3.32e-166 1..224 1..224
Hs1CysPrx01 456 3.32e-166 1..224 1..224
Ggo1CysPrx01 456 3.32e-166 1..224 1..224
Gene structure Fichier Exons►


exon

Literature and cross-references Ptro1CysPrx01 (Prx VI)
Protein ref. GenBank:   XP_001148286
DNA ref. GenBank:   NC_006468.2 (152977801..152988275)
Protein sequence: Ptro1CysPrx01 (Prx VI)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   224
PWM (Da):   %s   24922.14  
PI (pH):   %s   6.29
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAE
KDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP*

Retrieve as FASTA  
Remarks Genomic (Chromo 1, 4 introns). 1 EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST