Entry information : Pno1CysPrx01
Entry ID 4978
Creation 2007-03-11 (Nicolas Rouhier)
Last sequence changes 2007-03-11 (Nicolas Rouhier)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: Pno1CysPrx01
Name Pno1CysPrx01
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Phaeosphaeriaceae Phaeosphaeria
Organism Phaeosphaeria nodorum (Stagonospora nodorum)    [TaxId: 13684 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pno1CysPrx01
start..stop
S start..stop
Afum1CysPrx 331 1.36e-115 2..254 37..266
Nf1CysPrx 330 2.79e-115 2..254 37..266
Ate1CysPrx 326 1.08e-113 52..254 64..263
Ani1CysPrx02 317 2.73e-110 2..254 1..260
Gene structure Fichier Exons


exon

Literature and cross-references Pno1CysPrx01
Literature Birren B. et al. The Broad Institute Genome Sequencing Platform Annotation of the Phaeosphaeria nodorum SN15 genome. Unpublished. Submitted (29-MAR-2005)
Protein ref. UniProtKB:   Q0UZM9
DNA ref. JGI genome:   scaffold_4 (499101..497364)
mRNA ref. GenBank:   EAT89516
Protein sequence: Pno1CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   257
PWM (Da):   %s   28538.75 Transmb domain:   %s   i5-27o
PI (pH):   %s   7.79
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIAQHFGRGFIAVLSTTLAASPYAIIAKYSPRFRSSLRFFNVHFYVEVDRAKTTHGDLDFHKFIDGKWVVLFSHPADFTPVCTTELGAFAKLKPEFDARGVQMIGLSANDLTSHDEWVKD
INEVGNTQVTFPIIADADRHVAFLYDMISQDDLDNLAKNGGIAFTIRSVFIIDPAKKIRLTMTYPASTGRNTSEVLRVIDGLQLADKKGIATPINWNAGEDVIVPPSVSTEDARKKFGQD
NVREVKKYLRYTNVGK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Strain="SN15".
DNA
Send to BLAST
CDS
Send to BLAST