Entry information : MtPrx43 (Medtr2g084010.1[4.0] / Medtr2g084010.1[3.5] / Medtr2g098070.1[3.0])
Entry ID 5081
Creation 2007-03-27 (Christophe Dunand)
Last sequence changes 2007-03-27 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-07-29 (Messaoudi)
Peroxidase information: MtPrx43 (Medtr2g084010.1[4.0] / Medtr2g084010.1[3.5] / Medtr2g098070.1[3.0])
Name (synonym) MtPrx43 (Medtr2g084010.1[4.0] / Medtr2g084010.1[3.5] / Medtr2g098070.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx035]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Roots
Inducer Elicitor treatment (glucan, oligosaccharides, yeast extract, Phytophthora crude extract)
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx43
start..stop
S start..stop
MtPrx28 596 0 1..318 1..318
PsPrx11 553 0 1..318 1..318
MtPrx97 548 0 1..318 1..317
MtPrx57 537 0 1..318 1..317
Gene structure Fichier Exons


exon

Literature and cross-references MtPrx43 (Medtr2g084010.1[4.0] / Medtr2g084010.1[3.5] / Medtr2g098070.1[3.0])
Literature Hahn,M.G., Ojanen-Reuhs,T., Samac,D., Town,C.D., Van Aken,S., Utterback,T., Cho,J. and Fraser,C.M. ESTs from roots of Medicago truncatula treated with oligogalacturonides of DP 6-20.
DNA ref. Phytozome 12:   chr2 (35282306..35279947)
EST ref. GenBank:   CB893676
Cluster/Prediction ref. Phytozome Gene 12:   31068148
Omic ref. Gene atlas:   Mtr.11354.1.S1_at Legoo:   Mtr.11354.1.S1_at
Protein sequence: MtPrx43 (Medtr2g084010.1[4.0] / Medtr2g084010.1[3.5] / Medtr2g098070.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (295)
PWM (Da):   %s   34242.4 (31803.1) Transmb domain:   %s   i13-35o
PI (pH):   %s   8.81 (8.75) Peptide Signal:   %s   cut: 24 range:24-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATLNKLFVTLSILSLFACSTNAQLFPNFYGRTCPSLQTIVRREM
TKAINNEARIGASILRLFFHDCFVN
GCDGSILLDDTSTFTGEKNAGPNKNSARGFEVIDAIKTSVEAACSATVSCADILALATRDGIALLGGPSWIVPLGRRDARTASQSAANTQIPSPASDLSTLTKMFQNKGLTLRDLTVLSG
AHTIGQAECQFFRNRIYNETNIDTNFATLRKANCPLSGGDTNLAPLDSVSPVTFDNNYYRDLVANKGLLNSDQALFNGVGSPVSLVRAYSINGFAFRRDFAFAMVKMSRISPLTGTNGEI
RKNCRLVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, introns 1 and 2) and ESTs (CB893676, GE347117 and BF521344).
DNA
Send to BLAST
CDS
Send to BLAST