Entry information : GmPrx[P]01
Entry ID 510
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2011-12-14 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: GmPrx[P]01
Name GmPrx[P]01
Class Class III peroxidase     [Orthogroup: Prx167]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Etiolated hypocotyls
Germinating shoots
Leaves
Roots of 'Supernod' plants
Whole seedlings
Inducer Auxin treatment
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]01
start..stop
S start..stop
GmPrx01 318 1.84e-110 1..186 145..329
MtPrx111 300 1.45e-103 1..186 141..325
MtPrx30 295 1.22e-101 1..186 142..326
PvPrx01 283 1.31e-96 1..186 141..325
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '510' 'join(10100763..10100907,10101273..10101688)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10100763..10100907 143 N° 2 10101273..10101688 414  
join(10100763..10100907,10101273..10101688)


exon

Literature and cross-references GmPrx[P]01
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm15 (10100763..10101688)
Protein sequence: GmPrx[P]01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   187
PWM (Da):   %s   20448.26  
PI (pH):   %s   7.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
VPLGRRDSLTANRTLANQNLPAPFFTLDKLKAAFAVQGLNTLDLVTLSGGHTFGRARCSTFINRLYNFNNTGNPGPTLNTTYLELLRARCPQNATENNLTSLDLTTPDQFDNRYYSNLQQ
LNGLLQSDQELFSTPGADTIPIVNSFISxNQNTFFANFRVSMIKMGNIGVLTGDEGEIRSQCNFVNY

Retrieve as FASTA  
Remarks Pseudogen sequence from genomic (only exons 3 and 4). No prediction from phytozome.
join(10100763..10100907,10101273..10101688)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTCCATTAGGAAGAAGGGATAGCTTAACAGCAAACCGAACTCTTGCAAATCAAAATCTTCCAGCACCCTTCTTCACATTGGATAAACTCAAAGCTGCCTTTGCTGTTCAAGGTCTCAAC
ACCCTTGATTTAGTTACACTCTCAG
AGGTATACATATATAGTCAAATTCATATTTACTAATATAGGCATATATAGATAAATTTCACCATAAAAATTTATAATAAATGAAATAAGAAGATA
AAATGAATTAATTAAGCTTCTCATATAAACTAATTTAAGGTGCATCAATGGATTTCATCTTATGAATTAATTTAAGAAGAGGTAAAATAAATTGAACTTCTCGCATCAACTTATGTACTT
AAATTTTATATATAGAAGCTCTTTGCATTCGACTTCTACAAAAATCAAGGCGCATCGATCAATGTAGAGGTTTATCTGATCTAAAGAGAAAAATGTACAATTACACAACATGTAGTAAGC
CTAATTTCAAACTATGTTTGACATATATACAGGTGGTCATACGTTTGGAAGAGCTCGTTGCAGTACATTCATTAACCGATTATACAACTTCAACAACACTGGAAACCCTGGTCCAACTCT
GAACACAACTTACTTAGAACTATTGCGTGCGAGATGCCCCCAGAATGCAACTGAGAATAACCTCACCAGTTTGGACCTGACCACACCTGATCAATTTGACAACAGATACTACTCCAATCT
TCAGCAGCTAAATGGCTTGCTTCAGAGTGACCAAGAACTTTTCTCCACTCCTGGTGCTGATACTATTCCCATTGTCAACAGCTTCATCAGTNNNAACCAGAATACTTTCTTTGCCAACTT
TAGAGTTTCAATGATAAAAATGGGTAATATTGGAGTTCTGACTGGGGATGAAGGAGAAATTCGCTCGCAATGTAATTTTGTGAATTAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTCCATTAGGAAGAAGGGATAGCTTAACAGCAAACCGAACTCTTGCAAATCAAAATCTTCCAGCACCCTTCTTCACATTGGATAAACTCAAAGCTGCCTTTGCTGTTCAAGGTCTCAAC
ACCCTTGATTTAGTTACACTCTCAG
GTGGTCATACGTTTGGAAGAGCTCGTTGCAGTACATTCATTAACCGATTATACAACTTCAACAACACTGGAAACCCTGGTCCAACTCTGAACACA
ACTTACTTAGAACTATTGCGTGCGAGATGCCCCCAGAATGCAACTGAGAATAACCTCACCAGTTTGGACCTGACCACACCTGATCAATTTGACAACAGATACTACTCCAATCTTCAGCAG
CTAAATGGCTTGCTTCAGAGTGACCAAGAACTTTTCTCCACTCCTGGTGCTGATACTATTCCCATTGTCAACAGCTTCATCAGTNNNAACCAGAATACTTTCTTTGCCAACTTTAGAGTT
TCAATGATAAAAATGGGTAATATTGGAGTTCTGACTGGGGATGAAGGAGAAATTCGCTCGCAATGTAATTTTGTGAATTAC

Retrieve as FASTA