1. Browse the Database
  2. View Redoxidase
Entry information : AfumDyPrx03
Entry ID 5102
Creation 2007-10-22 (Christophe Dunand)
Last sequence changes 2012-01-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-26 (Christophe Dunand)
Peroxidase information: AfumDyPrx03
Name AfumDyPrx03
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Neosartorya
Organism Aspergillus fumigatus    [TaxId: 746128 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AfumDyPrx03
start..stop		 S start..stop
NfDyPrx 909 0 28..504 1..477
AorDyPrx03 665 0 28..502 1..471
AflDyPrx03 660 0 28..502 1..471
NtetDyPrx01_2508 342 1.45e-112 40..498 7..496
Gene structure Fichier Exons►


exon

Literature and cross-references AfumDyPrx03
Literature Nierman W.C. et al. Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus. Nature 438:1151-1156(2005).
Protein ref. GenPept:   EAL86784 UniProtKB:   Q4WH07
DNA ref. GenBank:   AAHF01000009 (377028..378933)
Protein sequence: AfumDyPrx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   504 (487)
PWM (Da):   %s   56276.33 (54352.4)  
PI (pH):   %s   7.39 (7.39) Peptide Signal:   %s   cut: 18 range:18-504
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFFSSLTLTIYLTYATACSTTIPLSDNMTSERINKPEINKDNIQG
NIWPGVPKLHEFFLFFNITSERRFRRDLKRLIPLVTTANDAVKFNEQIRQNKTEVSSGEAKSEVIPLTGVNLAFSAKGLKLFKDDKDNLKSGNFLGGMLADLQGGVAGGEGRDNPDDWEAKF
KPEVEDQYIDGVILVTGRSEQTARAKLREVKYIFIGYFGFTSSIRELFIEYGHVRPDPNESKEHFGYRDLISQPQLEGLDPAPKGKYEPPLVPPGYIITNADQEPVGQPDWATDGSFLVF
RKLKQLVPEFNKWLDGTAPKHHLTTDQLSARLMGRWKGAPTFLTPCKDDPSLADCNNFDFQPGNSQEKCPFAAHIRKCRPRGDVKDTSTSSMMRRGIPYGDEVTKEENDEQITKKERGMF
FLCYQSNIANGFRRVQEQWCNKNTFPPLKRGITGPPGPGADPICGQSNGPDPFVMGLCDGQNNNIHVDLKSCVIPKGGEYFFSPSIKALTNIAKQ

Retrieve as FASTA  
Remarks Complete sequence from Genomic (chromo 7, 8 exons). Strain="Af293 / CBS 101355 / FGSC A1100". Sequence was corrected from genomic NCBI data (START was predicted a little too early) and SwissProt data (large deletion wrongly predicted) with SoftBerry (FGeneSH).
DNA ►
Send to BLAST
CDS►
Send to BLAST