Entry information : GmPrx27 (Glyma02g05930.1)
Entry ID 512
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-16 (Achraf Jemmat)
Peroxidase information: GmPrx27 (Glyma02g05930.1)
Name (synonym) GmPrx27 (Glyma02g05930.1)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Roots
Roots of 'Supernod' plants
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx27
start..stop
S start..stop
GmPrx273 634 0 1..331 1..331
MtPrx25 555 0 1..330 1..330
RcPrx17 551 0 1..331 1..331
NnPrx50 544 0 1..331 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4762280..4762504 225 N° 2 4761847..4762038 192 N° 3 4761356..4761521 166 N° 4 4760663..4761075 413
complement(join(4760663..4761075,4761356..4761521,4761847..4762038,4762280..4762 504))


exon

Literature and cross-references GmPrx27 (Glyma02g05930.1)
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm02 (4762504..4760663)
Protein sequence: GmPrx27 (Glyma02g05930.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332
PWM (Da):   %s   36813.27  
PI (pH):   %s   7.04
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MANSMSFFLLLSFLAFAPLCLCHYNQEGYLYPQFYDYSCPQAQHIVKSVLAKYVAEQPRLAASILRLHFHDCFVKGCDASLLLDSSESINSEKGSNPNRNSARGFEVIDAIKAELERQCPSTVSCADILTLAARDSVVLTGGPNWEVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLQGLDLVDLVALSGGHTIGNARCTTFRQRLYNQSGNGEPDSTLDQYYASTLRTRCPSSGGDQNLFFLDYATPYKFDNSYFKNLLAYKGLLSSDQVLFTMNQESAELVKLYAERNDIFFEHFAKSMIKMGNISPLTNSRGEIRENCRRINA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 6 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAATTCCATGAGCTTTTTCCTGCTTCTTTCTTTTCTAGCTTTTGCTCCCTTGTGCCTCTGTCACTATAACCAAGAGGGTTACCTCTACCCTCAGTTTTATGACTATTCATGCCCA
CAAGCTCAACATATTGTCAAGTCTGTCCTTGCTAAGTATGTTGCAGAGCAACCTCGATTGGCGGCTTCGATTCTCAGGCTTCATTTCCATGATTGTTTTGTCAAG
GTCACTCCCTTTGAC
TTAGTCATTTATAGCACAAAAACATCACATTATTAGCATTAATATCATAAATAATTATGTGATGTTAGTAATTAATCTTATTGGTAAACATAGTTATATTAATATGTGATGTTTAGTACT
TAGTCTTATTGGTAAATATATATAGTTGTTTTTTTTTAAAAGAAAATATATATTGTTGTTTATCCAATTGTTATTTGAAATGCTTAATTCCAATTTGATGTTGCAGGGTTGTGATGCTTC
GTTGTTGTTAGATAGCAGTGAAAGCATCAACAGTGAGAAGGGATCAAATCCCAACCGTAATTCAGCTAGAGGATTTGAAGTCATTGATGCAATTAAAGCCGAACTAGAGAGACAATGCCC
TTCTACTGTGTCTTGTGCTGACATCTTGACTCTAGCTGCAAGAGATTCAGTTGTTCTT
GTAAGTGACTCCTTTTGCTTTATACTTCAGACTCTCCCTTATGGTGGATTTGGTAACTATGG
TTTGAAAAAATGTTTTTTATCTTTACACTTTTATTTTTAATTACAAAATACTACTTTGTTTTCATGTTATTTTTTATTTCTTAAAGTTTGAGTAGGAAATAGTTAAATTAACTTTTGTTG
TTTTCCTATTTTCTATACAAATTTTTAAATACAGGAAGTAAAGTAAAATAAGGTGATACCTTTGTAGTTAAAAGTGAAAATAGAAAATAAGAATAAAAAATATTTCTCAAATTAAACCAT
TCACTACTATCTCTTTTATGTAGACTGGTGGACCAAACTGGGAAGTACCTTTAGGCAGAAGGGACTCACTAGGTGCAAGCATAAGTGGCTCCAACAACAACATCCCAGCCCCAAACAACA
CATTCCAGACAATTCTAACTAAATTCAAGCTTCAGGGACTTGACCTTGTTGATCTAGTTGCTCTATCAG
GTATACACTCCTTAAAAACTTTTCTATTTCTAAACTTTTATGTTCAGGTTG
AATTGTGGTTAAATTTGGATTGACATAATCATCTAATCATATCATTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTATTTTA
TAATCGTCCAATTATATTAAATTTATCACCATGTTGTCATGCACCAACTTGAATCAAAGTTCACCTCACTTTCATTAATTGCTAAACGATTTTTGTGCAATTGCTATAGGGGGGCACACT
ATAGGAAATGCCAGGTGCACCACCTTCAGGCAAAGACTCTACAACCAAAGTGGCAATGGCGAGCCAGATTCCACTCTTGACCAATACTATGCTTCTACATTGCGTACAAGGTGTCCAAGC
TCTGGGGGTGACCAGAATCTGTTCTTCCTAGACTATGCCACCCCATATAAATTTGACAACAGCTACTTCAAGAACCTGTTGGCCTACAAGGGTCTCTTGAGTTCAGACCAAGTCCTCTTC
ACAATGAACCAAGAATCTGCTGAACTAGTGAAGTTGTATGCTGAAAGAAACGACATTTTCTTTGAACATTTCGCCAAGTCCATGATCAAGATGGGAAACATATCTCCTCTGACGAATTCA
AGGGGAGAGATCAGAGAGAACTGCAGGAGGATTAACGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAATTCCATGAGCTTTTTCCTGCTTCTTTCTTTTCTAGCTTTTGCTCCCTTGTGCCTCTGTCACTATAACCAAGAGGGTTACCTCTACCCTCAGTTTTATGACTATTCATGCCCA
CAAGCTCAACATATTGTCAAGTCTGTCCTTGCTAAGTATGTTGCAGAGCAACCTCGATTGGCGGCTTCGATTCTCAGGCTTCATTTCCATGATTGTTTTGTCAAG
GGTTGTGATGCTTCG
TTGTTGTTAGATAGCAGTGAAAGCATCAACAGTGAGAAGGGATCAAATCCCAACCGTAATTCAGCTAGAGGATTTGAAGTCATTGATGCAATTAAAGCCGAACTAGAGAGACAATGCCCT
TCTACTGTGTCTTGTGCTGACATCTTGACTCTAGCTGCAAGAGATTCAGTTGTTCTT
ACTGGTGGACCAAACTGGGAAGTACCTTTAGGCAGAAGGGACTCACTAGGTGCAAGCATAAGT
GGCTCCAACAACAACATCCCAGCCCCAAACAACACATTCCAGACAATTCTAACTAAATTCAAGCTTCAGGGACTTGACCTTGTTGATCTAGTTGCTCTATCAG
GGGGGCACACTATAGGA
AATGCCAGGTGCACCACCTTCAGGCAAAGACTCTACAACCAAAGTGGCAATGGCGAGCCAGATTCCACTCTTGACCAATACTATGCTTCTACATTGCGTACAAGGTGTCCAAGCTCTGGG
GGTGACCAGAATCTGTTCTTCCTAGACTATGCCACCCCATATAAATTTGACAACAGCTACTTCAAGAACCTGTTGGCCTACAAGGGTCTCTTGAGTTCAGACCAAGTCCTCTTCACAATG
AACCAAGAATCTGCTGAACTAGTGAAGTTGTATGCTGAAAGAAACGACATTTTCTTTGAACATTTCGCCAAGTCCATGATCAAGATGGGAAACATATCTCCTCTGACGAATTCAAGGGGA
GAGATCAGAGAGAACTGCAGGAGGATTAACGCTTGA

Retrieve as FASTA