1. Browse the Database
  2. View Redoxidase
Entry information : MtAPx07-B ( Medtr3g088160.1[4.0] / MtAPx07-b)
Entry ID 5136
Creation 2007-04-06 (Christophe Dunand)
Last sequence changes 2016-04-07 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-04-07 (Christophe Dunand)
Peroxidase information: MtAPx07-B ( Medtr3g088160.1[4.0] / MtAPx07-b)
Name (synonym) MtAPx07-B ( Medtr3g088160.1[4.0] / MtAPx07-b)
Class Ascorbate peroxidase    [Orthogroup: APx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation Thylakoid-bound
Tissue type Seedlings
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtAPx07-B
start..stop		 S start..stop
MtAPx07-A 796 0 1..387 1..387
GmAPx07 734 0 1..437 1..433
CcampAPx06 700 0 1..436 1..436
CcampAPx05 697 0 1..436 1..436
Gene structure Fichier Exons►


exon

Literature and cross-references MtAPx07-B ( Medtr3g088160.1[4.0] / MtAPx07-b)
Literature Maunoury,N., Redondo-Nieto,M., Vaubert,D., Horvath,G., Mergaert,P. and Kondorosi,E. Expressed sequence tags from Medicago truncatula R108 young nodule library
Protein ref. UniProtKB:   G7J4Y2
DNA ref. Phytozome 12:   chr3 (39980002..39986334)
Cluster/Prediction ref. Phytozome Gene 12:   31057725 UniGene:   Mtr.6518
Protein sequence: MtAPx07-B ( Medtr3g088160.1[4.0] / MtAPx07-b)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   436 (292)
PWM (Da):   %s   47438.4 (30997.4) Transmb domain:   %s   o416-435i
PI (pH):   %s   9.38 (7.70) Peptide Signal:   %s   cut: 28 range:28-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MADRVLLTPSLSSSPTTMATITGGAAARMIPSATRATVSLSTSRSFFSFSLASSSRSVSSLNCLRSSPRISHIFLNQRRGEVRVSSGRFGTVAFASDPDQLKSAREDIKELLKTKFCHPL
LIRLGWHDAGTYNKNIEEWPQRGGANGSLRFEVELKHGANAGLVNALKLLQPIKDKYSGVTYADLFQLASATAVEEAGGPKIPMKYGRVDVTGPEQCPEEGRLPDAGPPSPADHLRQVFY
RMGLNDKEIVALSGAHTLGRSRPDRSGWGKPETKYTKDGPGAPGGQSWTAQWLKFDNSYFKDIKEKKDEDLLVLPTDAALFDDPSFKVYAEKYAVDQEAFFKDYAEAHAKLSNLGAKFEP
AEGVVVDGSPNVVGEKFVAAKYSSGKKELSDAMRKKIRAEYEAVGGSPDKALKSNYFLNIIIVIAALAILTYLFGN*

Retrieve as FASTA  
Remarks Complete sequence from at least 4 ESTs. Splicing variant of MtAPx07-a. The absence of sequence between SGK and ELSD is confirmed with the ESTs DY617089, BG455730 and BG457350. 3 ESTs out of 4 (all ESTs from TIGR TC accession) are also included in UniGene Mtr.6518. However it is impossible to distinguish which one belongs to each splicing variant.
DNA ►
Send to BLAST
CDS►
Send to BLAST