Entry information : PtDiOx01 (POPTR_0008s10590 / Potri.008G106400)
Entry ID 5158
Creation 2007-04-08 (Christophe Dunand)
Last sequence changes 2010-07-08 (Marie Brette (Scipio))
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtDiOx01 (POPTR_0008s10590 / Potri.008G106400)
Name (synonym) PtDiOx01 (POPTR_0008s10590 / Potri.008G106400)
Class Alpha-dioxygenase    [Orthogroup: DiOx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue types Buds
Leaves
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtDiOx01
start..stop
S start..stop
VvDiOx02 1083 0 11..641 7..637
CclDiOx02 1083 0 6..642 2..639
NatDiOx01 1040 0 8..641 8..641
VvDiOx01 1040 0 1..641 1..641
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6633262..6633381 120 N° 2 6633466..6633729 264 N° 3 6633980..6634129 150 N° 4 6634232..6634365 134
N° 5 6634950..6635163 214 N° 6 6635282..6635427 146 N° 7 6635551..6635778 228 N° 8 6636481..6636683 203
N° 9 6636997..6637240 244 N° 10 6637692..6637917 226  
join(6633262..6633381,6633466..6633729,6633980..6634129,6634232..6634365,6634950 ..6635163,6635282..6635427,6635551..6635778,6636481..6636683,6636997..6637240,66 37692..6637917)


exon

Literature and cross-references PtDiOx01 (POPTR_0008s10590 / Potri.008G106400)
Literature REFERENCE 1; DOE Joint Genome Institute and Stanford Human Genome Center. Direct Submission.
REFERENCE 2; Ralph,S. et al:, Genomics of hybrid poplar (Populus trichocarpax deltoides) interacting with forest tent caterpillars (Malacosoma disstria): normalized and full-length cDNA libraries, expressed sequence tags, and a cDNA microarray for the study of insect-induced defences. Mol. Ecol. 15 (5), 1275-1297 (2006).
Protein ref. UniProtKB:   A9PFX6 [Fragment]
DNA ref. Phytozome 12:   scaffold_8 (6633262..6637917)
mRNA ref. GenBank:   EF147254 [Fragment]
Cluster/Prediction ref. UniGene:   Pth.9070
Omic ref. ePlant:   Potri.008G106400
Protein sequence: PtDiOx01 (POPTR_0008s10590 / Potri.008G106400)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   642 (302)
PWM (Da):   %s   72962.71 (33276.8)  
PI (pH):   %s   7.28 (8.20) Peptide Signal:   %s   cut: 33 range:33-334
Sequence 683
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIRLTELIKKLSSASLRRFIHQDFHEVVDRMTIIDAFLFLIVHSIDKLGIWHRLPVFLGLLYLSVRRHLHQEYSLFNVGRSPTGVRYNPADYPYRTADGKYNEPFNEGAGSQGTFFGRNVLPVNQQDKLKKPDPMVVATRLLARKKFIDTGKQFNMIAASWIQFMIHDWVDHMEETAQIELVAPKEVANQCPLKSFRFYKTKEVPTGFWDIKSGALNIRTPWWDGSAIYGSNEKRLHKVRTFKDGKLKISEDGLLLHDQDGIAVSGDVRNSWAGVSILQALFVKEHNAVCDTLKREYKDLGDEELYRHARLVTSAVIAKVHTIDWTVELLKTDTLLAGMRGNWYGLLGKNFKDKFGHVGGAILGGVVGLKKPENHGVPYSLTEEFVSVYRMHSLLPDHLQLRDISAAPDSHKSPPSTDKIPMPSLIGRGGEKTLSGIGFIKLMVSMGHQASGALEPWNYPMWLRDVVAQEVDGTDRPDHVDLAALEVYRDRERNVARYNEFRRALLLIPISKWEDVTDDQEVIEALHQVYGDEVEELDLLVGLMAEKKIKGFAISETAFIIFLIMATRRLEADRFFTSNFNEETYTKKGFEWVNSTESLKDVLDRHYPEMTAKWMNSASAFSVWDSPPPSPNPIPLLFRVPK

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns), 1 mRNA and 6 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGATTCGGCTAACAGAGCTGATAAAAAAATTATCAAGTGCATCTCTCCGTCGTTTCATCCACCAAGACTTCCATGAAGTTGTTGATAGGATGACCATTATTGATGCTTTTCTTTTCCTGG
TAAAACCCTGCTCCTCCTCTCTATAGATAATTTATTAATCCATATATGATGTAAATATTAGTATTTACGTTTTATACGTGCAGATTGTGCACTCCATTGATAAGCTGGGGATATGGCATC
GGTTGCCTGTATTCTTAGGCCTGCTTTATTTGTCTGTACGGAGGCACCTTCACCAGGAGTACAGCTTGTTCAATGTTGGGAGATCCCCTACCGGAGTTCGCTATAACCCAGCAGATTATC
CGTATAGAACAGCCGATGGAAAATATAACGAGCCCTTCAACGAGGGTGCAGGAAGCCAAGGAACTTTCTTTGGAAGAAACGTTCTCCCAGTAAATCAACAAGATAAG
GTACGGATACATA
TATGTGTTCCTCATGATTTCCCCTAAGAAATGGTAATGACAATTATAATTATTATTTTTAATTAAATGATCCCGACTTTAGATTTATAAATTTTAATTCAAAGATATTCCAGTAAAAGAG
ATATTGTAAAAAGCAGAAAAATATAATAATAACAATAAATTTTCTTCAAGAAGACGTTAATTTTTATTTTTTTTATGAATTAACAATATAAGATTTATCTATATTTTATATATGTAGCTA
AAGAAGCCAGACCCTATGGTCGTTGCCACAAGACTACTAGCTCGGAAAAAATTTATAGACACAGGAAAGCAATTCAACATGATAGCAGCTTCATGGATTCAGTTTATGATACATGACTGG
GTTGATCACATGGAAGAAACTGCGCAG
GTACGGCCTCATGAGAGTTTATAATATGTTTTTTTTTTAATCAAATTAAAGATCAGATATTTGACTTTTTCTTCTGTACCAATTATAACTAAA
TATTTGCAGATTGAGCTTGTTGCACCAAAGGAAGTTGCAAATCAATGCCCACTTAAATCTTTCAGGTTTTACAAGACGAAGGAAGTCCCCACTGGATTCTGGGATATCAAGAGTGGAGCG
TTGAATATTCGTACACCTTGGTG
GTATTTTTCGATGCTTAAGTGAAAACAGCTTAATCAAAAGGATTTCAAAACTTTACTAATTTTAATGGGTTCAGTAAATAAAAACCACAGTGGACAC
ATGAGTGAGCTCGCTCCATTTAGATTTCCACATTCTGAGATCCTAAAATGCTCTTTGTCTTCTATTTCTTGAAAATAGGGTATTTAAGAGACATTTAATTTCATTTCTTTGGAAGATATA
TAAAATCTTAAAAACAATTAATTTGGGAAGAAAACGATGCAAATACAAGCGCAATATATATTGCAATTTATAGGAATTTTGCACAATCGTTTCCATGAAAACATCCATAGAGTTTATTAT
ATATACATACACAAATCGCAGTGTATTTTTCAAATATTATTTTTTTACTCCTTGAGGTCCCCACAAAAGAAAAAACACCCACAAACAAACACATGTTTATTGCACGAGAAACACTAAATT
CCATATCTAACAAGAATTTCATCATAGAACAAATCTCATTCTAGATAGCAGCGGTCACAATATTTTTCAAAATAGTAGGTCCAAAAAAAAAAGAACTTGATACATTCTAAGAAATTAATA
CGTGCAGGGATGGAAGTGCTATATACGGGAGCAATGAAAAAAGGCTGCATAAGGTTAGAACTTTCAAAGATGGGAAGCTCAAGATATCTGAAGACGGCCTTCTCCTTCATGACCAAGATG
GGATTGCTGTTTCAGGAGATGTTCGCAATAGTTGGGCAGGTGTTTCCATTTTGCAAGCCCTCTTCGTTAAAGAGCATAACGCAGTTTGTGACACCCTCAAG
GTTTGTGTGTGTGTGTTTT
TATCACATTCGTAAGAAATACGCTGTTGCATTAATTTCATTTCTTGAAATTAAATGTTAATCCATAGATTAACTGATTTTATACGCTGCATATGTTTAGAGGGAATATAAGGACTTGGGA
GACGAAGAGCTATACCGGCATGCAAGGCTAGTGACTTCTGCAGTAATTGCAAAAGTTCATACAATTGATTGGACTGTTGAACTTCTCAAAACTGATACACTATTAGCAGGGATGCGAGGC
AATTG
GTATGTGAACCTCCAGCTCCGATAACATGGGTTGCTATGTACTATCTGTACATGATCATAACAGCGAATTAATATTGGCCATGATCCAAATTTAATTTATTGTCCTTCGTTTCTG
TTTTTTAGGTATGGGTTGTTGGGGAAAAACTTCAAGGACAAGTTTGGTCATGTTGGAGGAGCTATCTTGGGAGGTGTTGTGGGGCTTAAGAAGCCTGAAAACCATGGTGTCCCATATTCA
TTAACTGAGGAGTTTGTCTCTGTTTACAGAATGCACTCACTTCTCCCTGATCACCTTCAGCTTAGAGACATATCAGCTGCACCGGACTCTCACAAATCTCCGCCTTCAACTGACAA
GTAA
AATTCAAGTTGCCTTTTATTTTGATAAAATGGATTGGACATCCCTTTCCTCTTTCTTTCTTTCTTTCTTTCTTTTCAAAAAATATATAAATAGATAAAATACTTTAAAGTTATTTAAGGA
AAGCATGCTGATTATAAAAGAAGCAGGAGCAAAAGCACTCTCCTATAATTAACTTTTACTACTCTTTTTGAAATTAGATGCACACATACATACATACATACATACATTGTATAATACATA
CATACATACATACATGCATACATACATATATGTATGTATGTATCTATGTATGTATGTGTGCATCTTATCTCAAAAAGAGTAGTAAAAGTTAATTGTATGTATGTATGTATGTATGTATGT
ATGTATACATTATACAATGTATGTATGTATGCATGTATGTATGTATGTTTTCTTCAAAAGACAAGTTCTTTATCCCTTGTACTCTTATTAAAAGCTGCTAATTTATAAGCAAAACACAGC
TCAATAGATTCTTGATCTCACCATTCTTGTTTTACAAAAAAGCATTGCCTATTTTGATAACTTCATGCATTGACCATTCTTTCTTGGTTAGACTAATAAGAACGCTAGTCAACGTAATTA
TAATGTATCTTAGACATTGTTAATTAGTGTATTTAAAAAGAAGGAAGATAAATATGGAGAAAGTTCTGTTGTTGTTGATTTCGTGCATGCACGCGCAGGATACCTATGCCAAGTTTGATA
GGTCGTGGAGGAGAAAAAACATTATCTGGAATTGGATTTATCAAACTTATGGTTTCAATGGGCCACCAAGCTTCTGGGGCATTGGAACCATGGAATTATCCCATGTGGCTCAGGGACGTC
GTAGCACAGGAAGTTGATGGTACGGACCGGCCTGATCATGTAGACCTTGCCGCTCTTGAAG
GTAACGCTAGCCATTCATATGATCGTATTGTGAATATAGAAACTATTCAAAATTGAAGA
TTTGATGGAATTATTCCAAGTTTAAGAAATTTTTCTTGTTCTTTTACAGTCAACTCCTTTGACATTAAAAGTATTTTTGGGTACAAAAAGTTACATAGTATTTTGAAAAAATGAATGCTT
TTTATAATCTTATGATTCTTCAGGAAGTCATTGTAAATATTTACATTTGTATTAATACGCCTAACGCATGCAAATAACGTGGAGCTAATGCACATATATTTTGTTTGATCAAATATGAAT
AAATCGTCGCACAGTTTACCGGGACAGGGAGAGGAATGTTGCGAGGTACAATGAGTTTCGTAGGGCTCTACTACTGATACCCATCTCAAAATGGGAAGATGTAACGGATGATCAGGAGGT
GATAGAAGCTCTTCATCAAGTCTACGGTGATGAAGTGGAAGAGCTCGATCTTCTAGTGGGACTCATGGCAGAGAAGAAAATTAAAGGATTTGCAATTAGCGAGACTGCTTTTATTATATT
CCTTATCATGGCAACCAG
GTAAATATTTTTTATTTGTCGTAAGATGCGTGCATGGTGACCAATATAACCCCACTTCCTCTTATTAAATTCGTAATATAAAATCGGTCGAAATTGAGAGAC
TTGTCTTTGCCGCCGCCCCCTGAAAAAACTATTTCTTCAACAACTGCCCGCTATGCCATGTGGATTAATAAAAAAAGAGAGGGTGGGAAAGAGCACACCTAACTATAGTCACCTGGTAGT
TGGTACTAGACGGAACATGTTAATTAAGAGATTTTCCAGGTGATGCTAATTCATGTCCGAATATTTCAACCTCTGGAAAAATTATTGCAAAAGTTTTTATACATGTAATTTATAAGTAGA
AGTTACCTTTTTCCATAAAACAATATATCAATCACTTGTTATTATAATTCCTATGATCCAACATATATATCATGAGTTTTGATGACCCGAGGGATTAATGGACATGCAGGAGGTTAGAGG
CAGATAGGTTCTTCACAAGCAATTTCAACGAGGAAACATACACGAAGAAAGGATTTGAATGGGTGAATTCAACAGAGAGTCTGAAAGATGTCCTTGATCGTCATTATCCAGAAATGACTG
CAAAATGGATGAACTCAGCAAGTGCTTTCTCTGTTTGGGACTCGCCTCCACCTTCTCCCAATCCCATTCCTCTTCTTTTTCGAGTTCCGAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGATTCGGCTAACAGAGCTGATAAAAAAATTATCAAGTGCATCTCTCCGTCGTTTCATCCACCAAGACTTCCATGAAGTTGTTGATAGGATGACCATTATTGATGCTTTTCTTTTCCTGA
TTGTGCACTCCATTGATAAGCTGGGGATATGGCATCGGTTGCCTGTATTCTTAGGCCTGCTTTATTTGTCTGTACGGAGGCACCTTCACCAGGAGTACAGCTTGTTCAATGTTGGGAGAT
CCCCTACCGGAGTTCGCTATAACCCAGCAGATTATCCGTATAGAACAGCCGATGGAAAATATAACGAGCCCTTCAACGAGGGTGCAGGAAGCCAAGGAACTTTCTTTGGAAGAAACGTTC
TCCCAGTAAATCAACAAGATAAG
CTAAAGAAGCCAGACCCTATGGTCGTTGCCACAAGACTACTAGCTCGGAAAAAATTTATAGACACAGGAAAGCAATTCAACATGATAGCAGCTTCAT
GGATTCAGTTTATGATACATGACTGGGTTGATCACATGGAAGAAACTGCGCAG
ATTGAGCTTGTTGCACCAAAGGAAGTTGCAAATCAATGCCCACTTAAATCTTTCAGGTTTTACAAGA
CGAAGGAAGTCCCCACTGGATTCTGGGATATCAAGAGTGGAGCGTTGAATATTCGTACACCTTGGTG
GGATGGAAGTGCTATATACGGGAGCAATGAAAAAAGGCTGCATAAGGTTAGAA
CTTTCAAAGATGGGAAGCTCAAGATATCTGAAGACGGCCTTCTCCTTCATGACCAAGATGGGATTGCTGTTTCAGGAGATGTTCGCAATAGTTGGGCAGGTGTTTCCATTTTGCAAGCCC
TCTTCGTTAAAGAGCATAACGCAGTTTGTGACACCCTCAAG
AGGGAATATAAGGACTTGGGAGACGAAGAGCTATACCGGCATGCAAGGCTAGTGACTTCTGCAGTAATTGCAAAAGTTC
ATACAATTGATTGGACTGTTGAACTTCTCAAAACTGATACACTATTAGCAGGGATGCGAGGCAATTG
GTATGGGTTGTTGGGGAAAAACTTCAAGGACAAGTTTGGTCATGTTGGAGGAG
CTATCTTGGGAGGTGTTGTGGGGCTTAAGAAGCCTGAAAACCATGGTGTCCCATATTCATTAACTGAGGAGTTTGTCTCTGTTTACAGAATGCACTCACTTCTCCCTGATCACCTTCAGC
TTAGAGACATATCAGCTGCACCGGACTCTCACAAATCTCCGCCTTCAACTGACAA
GATACCTATGCCAAGTTTGATAGGTCGTGGAGGAGAAAAAACATTATCTGGAATTGGATTTATCA
AACTTATGGTTTCAATGGGCCACCAAGCTTCTGGGGCATTGGAACCATGGAATTATCCCATGTGGCTCAGGGACGTCGTAGCACAGGAAGTTGATGGTACGGACCGGCCTGATCATGTAG
ACCTTGCCGCTCTTGAAG
TTTACCGGGACAGGGAGAGGAATGTTGCGAGGTACAATGAGTTTCGTAGGGCTCTACTACTGATACCCATCTCAAAATGGGAAGATGTAACGGATGATCAGG
AGGTGATAGAAGCTCTTCATCAAGTCTACGGTGATGAAGTGGAAGAGCTCGATCTTCTAGTGGGACTCATGGCAGAGAAGAAAATTAAAGGATTTGCAATTAGCGAGACTGCTTTTATTA
TATTCCTTATCATGGCAACCAG
GAGGTTAGAGGCAGATAGGTTCTTCACAAGCAATTTCAACGAGGAAACATACACGAAGAAAGGATTTGAATGGGTGAATTCAACAGAGAGTCTGAAAG
ATGTCCTTGATCGTCATTATCCAGAAATGACTGCAAAATGGATGAACTCAGCAAGTGCTTTCTCTGTTTGGGACTCGCCTCCACCTTCTCCCAATCCCATTCCTCTTCTTTTTCGAGTTC
CGAAGTGA

Retrieve as FASTA