Entry information : VvAPx02 (GSVIVT01025551001 / Vitvi12X-PACid_17833519)
Entry ID 5170
Creation 2009-02-27 (Christophe Dunand)
Last sequence changes 2011-07-02 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-07-29 (Christophe Dunand)
Peroxidase information: VvAPx02 (GSVIVT01025551001 / Vitvi12X-PACid_17833519)
Name (synonym) VvAPx02 (GSVIVT01025551001 / Vitvi12X-PACid_17833519)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Vitaceae Vitis
Organism Vitis vinifera (Grape)    [TaxId: 29760 ]
Cellular localisation Cytosolic
Tissue types Berries
Buds
Inflorescences
Leaves
Seeds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VvAPx02
start..stop
S start..stop
CroAPx02 481 2e-175 1..250 1..250
CpapAPx02 481 2e-175 1..250 1..250
PtriAPx02 478 3e-174 1..250 1..250
CclAPx05 478 5e-174 1..250 1..250
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14113409..14113527 119 N° 2 14113130..14113304 175 N° 3 14112825..14112890 66 N° 4 14112435..14112483 49
N° 5 14112224..14112306 83 N° 6 14112003..14112082 80 N° 7 14111764..14111866 103 N° 8 14111583..14111641 59
N° 9 14111452..14111479 28  
complement(join(14111452..14111479,14111583..14111641,14111764..14111866,1411200 3..14112082,14112224..14112306,14112435..14112483,14112825..14112890,14113130..1 4113304,14113409..14113527))


exon

Literature and cross-references VvAPx02 (GSVIVT01025551001 / Vitvi12X-PACid_17833519)
Literature Goes da Silva,F., Iandolino,A., Lim,H., Baek,J., Leslie,A., Xu,J., Jones,K. and Cook,D. Expressed sequence tags from Vitis vinifera 'Cabernet sauvignon' berries at various developmental stages
DNA ref. Phytozome 12:   chr8 (14113527..14111452)
Cluster/Prediction ref. UniGene:   Vvi.737
Protein sequence: VvAPx02 (GSVIVT01025551001 / Vitvi12X-PACid_17833519)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   254
PWM (Da):   %s   27968.1  
PI (pH):   %s   5.4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKAYPIVSEEYQKAVEKCKRKLRGFIAEKKCAPLMLRLAWHSAGTYDVKTKTGGPFGTMKHPEELAHEANNGLDIAVRLLEPIKEQFPILSYGDFYQLAGVVAVEVTGGPEIPFHPGRQDKSEPPPEGRLPNATKGSDHLRDVFGHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTTNPLIFDNSYFKELLSGEKEGLIQLPSDKALLEDPVFRPLVEKYAMDEDAFFADYAEAHLKLSEVGFADAEEQG*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 8, 7 introns) and 15 ESTs. Cultivar="Pinot Noir", "PN40024" and "Cabernet Sauvignon". Also found in AM444673.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAAGGCTTACCCTATTGTGAGCGAGGAGTACCAGAAAGCAGTCGAGAAATGTAAGAGAAAGCTCAGAGGGTTCATCGCTGAGAAGAAATGTGCTCCACTGATGCTTCGACTAGCG
TAATATCTCTCCCCAAATATATGCTTGTGAACTAGTTGTTTTCGTGATTGTTTGTCGAGTGAGAAGGTGAGCATTGATCGTGTGTGGTTTGTTTTATATACAGATGGCACTCCGCTGGGA
CTTACGATGTGAAGACAAAAACAGGAGGTCCGTTTGGGACAATGAAGCACCCAGAGGAGCTTGCTCACGAAGCTAACAATGGTCTTGATATTGCTGTCAGGCTATTGGAACCGATCAAGG
AGCAATTTCCGATCCTCTCTTATGGAGACTTCTACCAG
GTATATTTGAATCATTGGTCTATAATCGCAGTGGAAGAAGTTGTTGTTTTTCCTTTTGAGTTCTCTTAGATTCTGTTTGGTT
GTGATTTTGAAGTATAGTTCATTAAAGAGCAAAAACTGATGCAATTTTTTATTCTAAAATTCAGATAGTTACTTGGGAAAAATCTGAAAATGGTGGATCATTTGTTATTACTTTTTGCTT
ATTAATTCTTGATTTTGGTTCTGTTTATCAATTGAAGTTGGCTGGAGTTGTTGCCGTTGAAGTTACTGGAGGGCCTGAGATCCCTTTTCACCCTGGGAGACAGGTTAGAGAACCTTCTTC
ATTATCATTTGGTTTGGTATATCTGATCTTACCAAAAAAGAAAAATTAAATATTCATGTTTTGTTAGTAGTTGATATGTCAAATTTAGTAGGATTAAGGAAGTGTGGGCAAGGTTGGATC
TTGGGATGAAAGTATCTGAACTTACTGCCTTTCTGTAGAAATATCACTTGAATGTGCCAGACATATAGTTATTCTATCTGTTCGCTTGAAGCTCCTTATAATTTCTAATTCTTCCATTCT
AAGTCATTAATTTGTTAGTAGGCATTTATTTTCCATGTTAGCGACTAGTTTAGGCACTAAAGAGCAGGTGTTTGTCAATCTCAGGACAAATCTGAACCACCCCCAGAAGGTCGCTTGCCT
AATGCAACTAAAG
GTTAGTGTGCTTTTTTATGTACTAAGAAGTAAAAGAAACAAAACTTGGGAATTTAAAATAGTGGAATGAGATGGTGATAGCTAGTTAAGTATTTGATGCTCTGTTTT
AATATTCTGCTTACTCTTCAGGTTCAGACCATCTAAGGGATGTATTTGGCCACATGGGTCTCAGTGACAAGGATATTGTTGCACTATCTGGTGGTCATACTCTGGTATGCTAAGACGGAT
GAAGTTCCTCCCATGTTCCTTTCACAATTTTGAGTGCTTTTGTGGGACTGGCATTTGGTGCTTTTGCAGAGACTTGGCAACTTGTTTTCTAATATGAATGATATTCCGTGGGAATTGCTT
TACAGGGGAGGTGCCATAAGGAGCGCTCTGGATTTGAAGGACCCTGGACTACTAATCCACTCATCTTTGATAACTCCTACTTTAAGTGAGTCATCTGGATAACACCAAAGAAAATTGGTT
AAAAATTGCAAGGACTGGTATAAGTAGAGCTTTCTTTGGACACACCGCTCTAATTCAAATTCTAACGGTCCTTTCAATTTTATTCCGTTTTTGTTTATCAGGGAGCTGCTTAGCGGGGAA
AAGGAAGGTCTTATCCAACTGCCATCAGACAAGGCTCTCCTAGAGGATCCAGTCTTCCGCCCACTGGTTGAGAAATATGCTATG
GTGCGTATTTTGTTCTGATTTATGACTGCTCAGAAT
TATTTACCAAATTTTACTACTGTATTTTTGTAGCAATATGTTCAAGAAGTTTCTTTGGGTTTGATCATGGTGATTTCTATCTTTAGGATGAGGATGCCTTCTTTGCTGACTATGCTGAAG
CCCATTTGAAGCTCTCAGAAGTTGG
GTAAGTAAAGGGCTTCCGTTTCATTCTTATGACTTTATATCTTTGCCTCGAGTCATCCTTAGTTTACAAGTTCGGAAATTTACTTAATGCATCCA
ATTTTTAGATTTGCTGATGCTGAGGAACAAGGATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAAGGCTTACCCTATTGTGAGCGAGGAGTACCAGAAAGCAGTCGAGAAATGTAAGAGAAAGCTCAGAGGGTTCATCGCTGAGAAGAAATGTGCTCCACTGATGCTTCGACTAGCA
TGGCACTCCGCTGGGACTTACGATGTGAAGACAAAAACAGGAGGTCCGTTTGGGACAATGAAGCACCCAGAGGAGCTTGCTCACGAAGCTAACAATGGTCTTGATATTGCTGTCAGGCTA
TTGGAACCGATCAAGGAGCAATTTCCGATCCTCTCTTATGGAGACTTCTACCAG
TTGGCTGGAGTTGTTGCCGTTGAAGTTACTGGAGGGCCTGAGATCCCTTTTCACCCTGGGAGACAG
GACAAATCTGAACCACCCCCAGAAGGTCGCTTGCCTAATGCAACTAAAGGTTCAGACCATCTAAGGGATGTATTTGGCCACATGGGTCTCAGTGACAAGGATATTGTTGCACTATCTGGT
GGTCATACTCTG
GGGAGGTGCCATAAGGAGCGCTCTGGATTTGAAGGACCCTGGACTACTAATCCACTCATCTTTGATAACTCCTACTTTAAGGAGCTGCTTAGCGGGGAAAAGGAAGGT
CTTATCCAACTGCCATCAGACAAGGCTCTCCTAGAGGATCCAGTCTTCCGCCCACTGGTTGAGAAATATGCTATG
GATGAGGATGCCTTCTTTGCTGACTATGCTGAAGCCCATTTGAAG
CTCTCAGAAGTTGG
ATTTGCTGATGCTGAGGAACAAGGATGA

Retrieve as FASTA