Entry information : ZmAPx-R (GRMZM2G047968[6a])
Entry ID 5183
Creation 2007-04-13 (Christophe Dunand)
Last sequence changes 2011-02-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-07-01 (Christophe Dunand)
Peroxidase information: ZmAPx-R (GRMZM2G047968[6a])
Name (synonym) ZmAPx-R (GRMZM2G047968[6a])
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Flowers
Mixed tissues
Seedlings
Silks
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmAPx-R
start..stop
S start..stop
SbAPx-R 559 0 1..337 1..333
SiAPx-R 520 0 1..337 1..334
ObrAPx-R 463 2e-165 1..337 1..331
BdiAPx-R 453 1e-161 1..337 1..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 189686061..189686146 86 N° 2 189686235..189686347 113 N° 3 189686518..189686608 91 N° 4 189686865..189686992 128
N° 5 189687232..189687302 71 N° 6 189687429..189687471 43 N° 7 189687560..189687656 97 N° 8 189687800..189687880 81
N° 9 189688194..189688325 132 N° 10 189688409..189688481 73 N° 11 189688582..189688684 103  
join(189686061..189686146,189686235..189686347,189686518..189686608,189686865..1 89686992,189687232..189687302,189687429..189687471,189687560..189687656,18968780 0..189687880,189688194..189688325,189688409..189688481,189688582..189688684)


exon

Literature and cross-references ZmAPx-R (GRMZM2G047968[6a])
Literature Qiu,F., Cui,F., Guo,L., Ashlock,D.A, Wen,T.J. and Schnable,P.S. Expressed Sequence Tags from B73 Maize Seedlings and Silks. Unpublished (2001)
DNA ref. Phytozome 12:   1 (189565110..189567815)
Cluster/Prediction ref. UniGene:   Zm.2846
Protein sequence: ZmAPx-R (GRMZM2G047968[6a])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337
PWM (Da):   %s   36343.58  
PI (pH):   %s   8.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MELNSIPYIASWSSSSSCFYYSYSRCACRGTRDGKLVTKASAAGRKRAADSVCSQLSEQGTEDSISGPRSSWRIRRRDLASAILLPFLIPRVNISIAAEIYDASIIRSGVRSVLTKGKAAGVLRLVFHDAGTFEIGDGSGGMNGSIIYEVDRPENIGLNRSIKILRKAKEGIDNVQKVSWADLIAVAGAEAVALCGGPEIPVRLGRVDSSADPSGKLPEETLDAASLKTLFSKKGFSAQELVVLSGAHTIGGKGFGSPVVFDNTYFKVLLDNRPPQTSSTGNGMAAMVGLRTDWALTEDDECLRWIRIYAEDQARFFDDFRDTYIKLVDSGASWRTA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 10 introns) and 15 ESTs (Unigene). Cultivar="B73". Incorrect prediction from Phytozome, sequence shift + mismatches with DNA from maizeseq.org. join(63..148,237..349,520..610,867..994,1234..1304,1431..1473,1562..1658,1802..1882,2203..2327,2411..2483,2584..2670)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCTCAACAGCATCCCCTATATTGCGTCGTGGTCTTCCTCCTCGAGCTGCTTCTACTACAGCTACAGTCGCTGCGCCTGCAGGTGATGTTAGAGAACTCTCGTTCCCGTACGCAAA
TGATGCAGTCTTGTCTGCATGGAAGCAAACGACCTGAGAAATCCTTATGTACAGAGGTACAAGAGATGGGAAGCTGGTAACAAAAGCTTCTGCAGCTGGTCGTAAGCGTGCTGCTGATTC
AGTATGTTCACAACTCTCTGAGCAGGGAACTGAAGATTCCATTTCAG
GTACACATCGCTGTTCTTAGCCTCATATATCACTTGGTTCCAAACCGTTTTTTTGCTGGAGCTGTAAATATTT
TAATGACAATGGGAAACTTTTTTGTTGCTTGGGCTGATGCCGGACCATGGAAATTTAGCATGGTCAACTCAAAGTTTCTCTTCTCTGGTGGTTCCAGGTCCTAGATCTTCCTGGCGTATA
AGGAGGAGAGACCTTGCTTCTGCCATTTTACTCCCTTTTCTGATTCCTCGTGTTAACATCTCTATCGC
GTAAGTAGTGCATTATTATCAAAGAATTTAGCTATCCAGCTCTTGAAATTAC
TAGCTGACATTCAAAAGAGCGTCTTCTTGATGTTTCAAATGGTAAATACTGTGAGAAAGGGGAAGCATGTAATGAGCCACAGTTGAATCTTGTAGACATAGGACAGTGATCTAGTAAAGG
AAAGATCCTTAAATCTGGTTTCTTGCTCCTAAAACAGTGATGCCATTGCCATCTATATGAGAAGTTATCTGGTTGATTTCACAGGGCTGAGATATACGACGCATCAATTATTCGAAGTGG
TGTGAGGAGTGTTTTAACCAAGGGCAAGGCTGCTGGTGTGCTTCGGTTGGTTTTCCATGATGCAGGGACTTTTGAAATTGGGGACGGATCAG
GTTAGCCTCTTTAGTGTGTTTGAGGGGA
AAAAAGCATTTGTGTACGAAAAAATGATCCAAAACGGTATTGCTAAGAAGATACAGAATTCTATTTTTAAAGGAAAGAAATATCATCATTTGTGGTGCATACATCGGTAGGATTGCTACC
TGACTGCTATATTAGTTCAGCAAAGAGACATGATATTAGTTCAGCAAAGAGACATGACTTTCGTCAGACTACTAACAGTGATACCTTCCAGGTGGCATGAATGGCTCTATAATTTATGAA
GTTGACAGGCCTGAAAACATTGGCCTAAATAGATCCATAAAG
GTGGGTGCGTGTCTTTGTGACGATAAATTGCTTTATCTTTACTCGTTTTCTTGAAGAATATCATATCCTTCTTGATGT
CGTATTTCCTTCAGTTGACGTCTACTTAATCACATCATAACTGAACAGATACTAAGAAAAGCAAAAGAAGGAATCGACAACGTTCAGAAAGGTATGTAAACCATGCCATCTTCTGTCCTG
CACTTTCTTTACGAAAACTCCAGTTTGGGAGTCAAATCTCCTGCTGTTTGCGCTGACAGTGTCGTGGGCGGATCTGATTGCCGTGGCTGGCGCTGAGGCAGTTGCGCTCTGTGGCGGGCC
TGAGATTCCAGTAAGGCTAGGAAGAGTAGATTCTAG
GTGAGAAATCACAGTGATTTTTTTTATTTTACTCCTCCAACTTACAGTTTTAAGAAAGCTATGTATGTATATAAATATTCCAGA
TTGTGTAGTGTCTTTGTATCAGTCAGTTTTCTGAAGAACATGGGTTATTTTTGCAACAGTGCTGACCCTAGTGGAAAAGTTCCTGAAGAAACATTGGAGGGGGGGTCCTTGAAGACATTA
TTAAGCGCCAAGGGCTCTTC
GTGAGATGCCCCCCACCCTAAAAGGGGGGGGGAGGAACTAGAAACTAATGCGGTTCTGCTATTGAAAAAAAGGAGAAAAAGACCATNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGATCCCCCCTTTTTTTTGTCAAATTAAATATAC
ATACGCATTCCAGTTCTCAATTTAATCCCCTGTGGCTTGCAGCCATTGTTCCCATATCCATGTCTGAAATCCATGTTTGGCGATTAACGACAGGGCGCAGGGAGCTGGTTGTTTTGTCGG
GAGCGCACACGATTGGAGGGAAAAGGGTTTCGGGAGTCCCAGTTGTTTTCGACAACACCTATTTCAAGGTGCTGCTCGATAATAGGCCGCCGCAGACATCTTCGA
GTAAGTGCATCTTCC
TCACCAATTGCTTTTGATTGATGTCTATGCTTTTATCAGAACTTACTGCGTGTTCCTCTGTGAAGAAGCTGGCAATGGCATGGCGGCGATGGTTGGGCTGCGCACGGACTGGGCGCTCAC
TGAAGACGACGAGTGCTTGAG
GTAGTTTATGAAACCTCAGCTACCTCGGTTTCTGAAGACACCAAGAAAATGCTAGATGCTCCATCAGCTTAATGACGCTGCGTATGTTTGAAACCTGCA
GATGGATCAGGATCTACGCAGAGGACCAAGCTAGGTTCTTCGACGACTTCAGGGACACGTACATCAAGCTCGTAGACAGCGGAGCCTCGTGGAGAACAGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCTCAACAGCATCCCCTATATTGCGTCGTGGTCTTCCTCCTCGAGCTGCTTCTACTACAGCTACAGTCGCTGCGCCTGCAGAGGTACAAGAGATGGGAAGCTGGTAACAAAAGCT
TCTGCAGCTGGTCGTAAGCGTGCTGCTGATTCAGTATGTTCACAACTCTCTGAGCAGGGAACTGAAGATTCCATTTCAG
GTCCTAGATCTTCCTGGCGTATAAGGAGGAGAGACCTTGCT
TCTGCCATTTTACTCCCTTTTCTGATTCCTCGTGTTAACATCTCTATCGC
GGCTGAGATATACGACGCATCAATTATTCGAAGTGGTGTGAGGAGTGTTTTAACCAAGGGCAAGGCTGCT
GGTGTGCTTCGGTTGGTTTTCCATGATGCAGGGACTTTTGAAATTGGGGACGGATCAG
GTGGCATGAATGGCTCTATAATTTATGAAGTTGACAGGCCTGAAAACATTGGCCTAAATAGA
TCCATAAAG
ATACTAAGAAAAGCAAAAGAAGGAATCGACAACGTTCAGAAAGTGTCGTGGGCGGATCTGATTGCCGTGGCTGGCGCTGAGGCAGTTGCGCTCTGTGGCGGGCCTGAGATT
CCAGTAAGGCTAGGAAGAGTAGATTCTAG
TGCTGACCCTAGTGGAAAAGTTCCTGAAGAAACATTGGAGGGGGGGTCCTTGAAGACATTATTAAGCGCCAAGGGCTCTTCGGCGCAGGGA
GCTGGTTGTTTTGTCGGGAGCGCACACGATTGGAGGGAAAAGGGTTTCGGGAGTCCCAGTTGTTTTCGACAACACCTATTTCAAGGTGCTGCTCGATAATAGGCCGCCGCAGACATCTTC
GA
CTGGCAATGGCATGGCGGCGATGGTTGGGCTGCGCACGGACTGGGCGCTCACTGAAGACGACGAGTGCTTGAGATGGATCAGGATCTACGCAGAGGACCAAGCTAGGTTCTTCGACGA
CTTCAGGGACACGTACATCAAGCTCGTAGACAGCGGAGCCTCGTGGAGAACAGCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTTTCATTT CAGAGCTGTG GTAGACTGGT AGGTTGGTAG CTGTTACTGA AAAACTAAGA GAAGGCAGGA CGGGGAAAGG AGATGGAGCT CAACAGCATC CCCTATATTG CGTCGTGGTC  TTCCTCCTCG AGCTGCTTCT ACTACAGCTA CAGTCGCTGC GCCTGCAGAG GTACAAGAGA TGGGAAGCTG GTAACAAAAG CTTCTGCAGC TGGTCGTAAG CGTGCTGCTG ATTCAGTATG  TTCACAACTC TCTGAGCAGG GAACTGAAGA TTCCATTTCA GGTCCTAGAT CTTCCTGGCG TATAAGGAGG AGAGACCTTG CTTCTGCCAT TTTACTCCCT TTTCTGATTC CTCGTGTTAA  CATCTCTATC GCGGCTGAGA TATACGACGC ATCAATTATT CGAAGTGGTG TGAGGAGTGT TTTAACCAAG GGCAAGGCTG CTGGTGTGCT TCGGTTGGTT TTCCATGATG CAGGGACTTT  TGAAATTGGG GACGGATCAG GTGGCATGAA TGGCTCTATA ATTTATGAAG TTGACAGGCC TGAAAACATT GGCCTAAATA GATCCATAAA GATACTAAGA AAAGCAAAAG AAGGAATCGA  CAACGTTCAG AAAGTGTCGT GGGCGGATCT GATTGCCGTG GCTGGCGCTG AGGCAGTTGC GCTCTGTGGC GGGCCTGAGA TTCCAGTAAG GCTAGGAAGA GTAGATTCTA GTGCTGACCC  TAGTGGTAAA CTTCCTGAAG AAACATTGGA CGCAGCTTCC TTGAAGACAT TATTCAGCAA GAAGGGCTTT TCGGCGCAGG AGCTGGTTGT TTTGTCGGGA GCGCACACGA TTGGAGGGAA  AGGGTTCGGG AGTCCAGTTG TTTTCGACAA CACCTATTTC AAGGTGCTGC TCGATAATAG GCCGCCGCAG ACATCTTCGA CTGGCAATGG CATGGCGGCG ATGGTTGGGC TGCGCACGGA  CTGGGCGCTC ACTGAAGACG ACGAGTGCTT GAGATGGATC AGGATCTACG CAGAGGACCA AGCTAGGTTT TTCGACGACT TCAGGGACAC GTACATCAAG CTCGTAGACA GCGGAGCCTC  GTGGAGAACA GCTTGACTAG AACTGCCTGT TTCTTTACAG TGTTAGGCCT TGTTCGGTTA TAAGGGAATA AATCCCCCCA TGGATTTAAT CCGGATCTGG ATTGGGTGAA TCCATATGTC  ACACCCAATC CTATGGTGGG ATTAAATACA CCATTTAATC CATGTATCTC TTAAAACTAG TTATTCTTTT GATTCATGGA TTTTAATATA AACTTGTGCA ACATCTTCAT GGATTTGCTC 
CATACATAAT GAGCTATGGA TAGAATCCAT GCCTTTCATA GTTT 

Retrieve as FASTA