Entry information : LeAPx-R (Solyc08g059760.2.1[2.3])
Entry ID 5186
Creation 2007-04-13 (Christophe Dunand)
Last sequence changes 2011-07-28 (Catherine Mathe)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-22 (Messaoudi)
Peroxidase information: LeAPx-R (Solyc08g059760.2.1[2.3])
Name (synonym) LeAPx-R (Solyc08g059760.2.1[2.3])
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Solanaceae Solanum
Organism Lycopersicon esculentum (Tomato)    [TaxId: 4081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LeAPx-R
start..stop
S start..stop
InAPx-R01 438 9e-156 51..326 67..341
IaquAPx-R01 432 2e-153 36..326 37..339
VvAPx-R 408 4e-144 16..323 14..328
GhAPx-R 398 1e-139 44..323 47..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..154 154 N° 2 246..366 121 N° 3 1268..1383 116 N° 4 1701..1771 71
N° 5 1959..2001 43 N° 6 2090..2186 97 N° 7 2552..2635 84 N° 8 4833..4954 122
N° 9 5329..5395 67 N° 10 5576..5681 106  
join(1..154,246..366,1268..1383,1701..1771,1959..2001,2090..2186,2552..2635,4833 ..4954,5329..5395,5576..5681)


exon

Literature and cross-references LeAPx-R (Solyc08g059760.2.1[2.3])
Literature Takahashi,H., Watanabe,Y., Arie,T., Ichinose,Y., Kodama,M., Ezura ,H. and Shibata,D. Full-length cDNA sequences from tomato (Solanum lycopersicum cv Micro-Tom) leaves treated with pathogens
DNA ref. GenBank:   AEKE02019264.1 (36453..30773)
Cluster/Prediction ref. UniGene:   Les.16652
Protein sequence: LeAPx-R (Solyc08g059760.2.1[2.3])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326
PWM (Da):   %s   35402.03  
PI (pH):   %s   5.52
Sequence 368
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSNTVAVDCWLLSSGVSSFTSTSKLYFPANFSRKPRFGSNTIRASATTNGSSEGVIYKALLCGRRALLSMITLPLVMPCERIDNSVGAIAADESFQVREEIRKVLSKSKAAGVLRLVFHDAGTFEIDEKTGGMNGSIVYELDRPENKGLKKSLKILDKAKSQIDLVQSVSWADIIALAGAEAVSLCGGPSIPIQLGRIDSMVQDPEGKLPEESLDAISLKQCFERKGFSTQELVALSGAHTLGSKGFGNPTVFDNEYFKILMEKPWLSSGSMTSMVGLPSDRALVEDDECVGWISKYAEDQSLFFDDFKNAYTKLVDTGATWKKAL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns) and 6 ESTs. Cultivar="Micro-Tom".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAGTAACACCGTCGCCGTCGATTGTTGGCTTCTCAGTTCCGGCGTTTCCTCCTTTACATCCACTTCCAAGTTGTACTTTCCGGCCAATTTTTCTCGAAAGCCACGCTTTGGTAGCAACA
CAATTCGAGCTTCCGCCACCACAAACGGTTCAA
GTAAGCAGTTAATCTTTAATTTCATGAAATATTAGATTTTATTATCTGAAATTTGTTGATATTTGTAAATGTGAGATTTTTCGAATT
ACAGGTGAAGGTGTTATTTACAAAGCGTTATTATGTGGAAGAAGAGCCTTACTATCTATGATTACCTTGCCTCTTGTTATGCCGTGTGAAAGAATTGACAATAGTGTTGGTGCCATTGCT
GCTGA
GTACGTTCAAATGTACTGCTTTTTAGAAATTTGTTTAGAGCTTTACTGCCTTTCGGATTTCACTTTCTTGTAAAATGAATCTTCCAAATTGTGGTGTTAATTGTCAAGAAATCTT
ATAGACAAAGATAAGTAAAACTTGCAAATAAGCATATTGGTTAACATGTAGTGTTGAAGACCATGTTCGACATTCAAAAGTTGAAGTGTTAAGTTCAGCACAATTCACATGTATTAATTA
GTTTATTTATGGATGATTCATATGTGCAAGTTCGATTTGAGAGTTCTCTCTAGCTAGTTGGGATATAGCAAAGACACTCCTTTCCAGTGATTATATATTTCTATGCCCCAATTAGATAAT
AAATTCTAAGAGAACATATGAGAGAATTTGACTTTGAAAGAGGAATGATTCTGCTCACATAAGGTGAATTTAGTTTATCATACTTCCACCGCTAGCATCAACCATTTTAGGAGTGATTTT
TTTCCCAAAATTCGTGATTACTGATTTCCTTATTGAAGGCACTTGACCAAATGTCCTTGAAGCATATAATTTGGTAGTAGAAAGTCGAAATATGAAACATTTTGAGAGTCATCCGTATGT
GAAGAAGATAGGTAGTTACTGCTTGGACTGAAAAAAAAGCATAGAGCGATAAGCTTGGTCACCTTTTCTGCTTTGTGTTAGCAGTTTCGAGTTTGTAATTGCAGGATGAATGTGAGGAAG
TGATTCTAAGGGGAGAAGTTCCGTTTTTGTCGACCCTCTTTGATTTCACTATCGAAATTAAGATCTCAAAAAAATATGCTTGACACTGTAATTATTTGTTTCAAGTTATTTCTTTTAAGC
AATGTAAAATGTAATTACTCCATATATTCCTAAAAGGAGCACTAACTTTCCGTTTGTTTTTGGCAGTGAGAGCTTTCAGGTAAGGGAAGAGATCAGGAAGGTATTATCCAAGAGCAAGGC
TGCTGGTGTACTTCGCCTTGTATTCCATGATGCAGGAACTTTTGAAATTGATGAGAAAACTG
GTAATACTTTGAAACGCTTAGTCCTATCCCTACCCCCCCCCCCCCCCCCAACTATTCC
AATCATTAGCATCTTTCAATTTGTAAGCTAATCACCTTATTTTAGAATCTACAGAGCTGGTCTATAAGTGTTATAACATCATAAATGCACATGGAAATGCTTCTTACACCATTAATTTGC
AAAACCTGTATATATCTTATTTTGTATTTATCCAAAAATATAATAAATTTGTGCAGTATGCAAATATACTTGAAAGAAGAAATTGTTTTGTCTTCCATTCCTGGATACATGATATCAACC
TCGATTGCTCTTATATTAGGGGGTATGAATGGCTCTATAGTATATGAACTCGACAGACCCGAAAACAAAGGCCTTAAGAAATCTCTAAAGGTAAGTAATTTTATTGCGTATACTCTTTTC
TTTTGTCTCTCCATCATTAGTTTTCTTTTAACCATCCTTGGGAACAGTCCGCAGATATTCTCATTTTAAATGTTAGTTGTTTACCATTTCCAAAGACTGATGAACTCTCATATGTACTTC
AACCAGCTAACATCTCGGTCCATGCATTGTTCTATAGATTCTGGACAAAGCGAAGAGTCAAATTGATCTTGTGCAATCAGGTAAACTGTCTCAGTCAATAAACTGCTGTTAGTTCACCTA
TCATTTTTGTTCCAGCATAACTTTTTTAATTGTTGGCTTTGTTCTCAGTCTCATGGGCTGATATAATAGCTTTGGCTGGAGCTGAAGCTGTTTCATTATGTGGTGGACCTAGTATCCCCA
TTCAGTTGGGAAGAATTGATTCAAT
GTAAGGGCTTTTTTAGTTTATGATAATGTTTACATTTTGCTATATAAGATGTTGGTCCAGTAAATGTGGAGAGAATTGCATCTATTTTTTTATTT
ATGCTGTTTAGAAATGGGGATGCAAAGATTTAATAATCAGGATCTTGTGAATCTCTTAAATTTAGCAATAGACAAGTAACTTACAATCTTAATTTAAGCCCTTTGTGGATAGTTCCTTCT
CATTCAAATTGATGGCGTTTATCCATCTAAGCACCAGGTGCCAGAAACTTACCATGAGGAAACCCCTAATGTATGAAGAAACCATATTTCAATTGATTGTCGTAATTTTCTTCCGTATCT
ACGTTGTCATAGTTGACTTTGACTATGTAGGGTGCAAGATCCTGAAGGAAAACTTCCTGAAGAATCACTAGATGCCATTAGCTTGAAGCAATGTTTTGAAAGGAAAGGCTTCTCGTGAGT
CTAATGGCTTATTTTTATTTCATCTTCTGCTCTCCTTGTGCTCCATGTTATACCATTCAATTAGCATTCTCATATTGTTTTGATGCCATTGACATAATTTGACTGGGTTTATTTTTGTCA
GTTGCTATTAGAGCAGATAAATAGATAATCTTGTTTGTACTTTTTATGTTTCCTTTGCTTTGCTTTAGTGGATAACAAAAGACTTTTAAGGGTTTTCCCCTTCAATAGCTTCTTCAGATG
AAGTAATGAGACTTGCGATTCACAAACTGTTGCATCTTTCTTGGCATTTCTAGTGTGTTCTTCACTTGCAACATTCTGATGTTGGGTAATCAGAGGCAGATCCTGGATTTGGAAGTCTAA
GCTTTATTGATGTTTAAAAAGCAGTAGCTATAATTAATCATCAATTATGTAAACATAGACGAGCCTTGACTCATTGGTCTGTTTGAGTTTTATTAGTGATCAAGGGTTTTCTTTCTCGAC
TGTACCAATTCTTTAACAATATATAGGCTCACTATATTTGTCAAAAAAACTGATCAAGCTGGACTTTTAACCGTTGCACCCCTATAATCTTCTAACCAACATTCCAGGAAGCTCTCTTTT
TTAGATTGTGGGCTTTTTGATTAGAATATGTGTAGTCCTCGATGCAGCACTAGTTTTAAAAAGTGCACCAGGCTTGGTTCTCACTCGCTTCCACGGATAGAAAAACCTGACTCTCCAACA
CTGCTACCATGTGCCCTATTGTTACTCCGGGTGCCAAGAATAGTATTTATATACATTTTCTCATACATATATACAGAGTGTCGTGGCACCCCCACACTTCTACATAGATCCAACCCCCGT
GGGATATACATAAAGTGATAAAACTATTTCTTTCAGGTTAAGCACTTCGCCAATGAACTGGCTTTGTAGCATCAGTAATCCTTTTTAATGAAATGCAGTGTAGACAAACATGGTGATAAA
TAACGTAGTTTGTCACTGTAGCTTGCGTGGATAAATAAGATTTGGTATTCACATGGAGTAGACTTAGTTCTGTACTCTTGTTTTCGTGGAAGTGAACGACCATTAGTTCTGCTCTATTTC
ATGAAGCATGTGAATTACTGCTGTATTTCTTCTGTTTCATATGCATCTGGTTTCTCTTTCTCCGGTGTTATAATGTTATGCGATTTAACATATTCTCTCACTTTCCAAGAGCTATTTTGG
ATTTTCTATATGATCGTTTCCTTGTCCTTCTGAGTTTCTAATGCATGGGTATGAGACTCTCATAGTTTAGCCCCTCTATTTGGATAATGCATGCGAATACTACTTATACAACATGTATAT
CAAGAACCGAAGAATGTGGCTTTATTAGAAAATTCAATTTAATGTACGCTGTGCTAACATTTGATAAGACAAACTGTATACACTAATTCATATTTTCCTGTACCAATATTAATGTAGCAT
ATAGGTTATAGTGAATTGTTAATCTCCATGACATACACAAATTTTCAAAATCATGCATAAGGAGCATATTGCACAGCCAGTGTCATCAAAAAAAGCATATTGCACAGCCAGTCTTTAGGA
GTAATCATTTTGAACCTTAGACCTCTTGGTCTTATTCTAGGCAATATTAAGGAACTCATCTGAAATGATGGTTTTAGAGAACGAAAAAGGGATATTATTTGATCGGTATCCTTCAAAATG
GGTTTATATTAAATGTATTCAAAATTTTCAATTGCAGGTCTTTCCCCATGTATGTTTTTCTTTTTGAGGCAATCTATATTCAATATGCAGGTAAAGTGTCAGTTGTATGATATTTTGTGA
GTATTCACATGATCATGGCCAAAAGAGCAGATTTAATTGCTCCATAATCTTTCCCCTGCCTCGAGGTTATGGAATTTCAGCTTAGCTGAATAAAATTCCATAACTCATGATTTTTTGCCT
CCTCTATTGGCTGCATCAGTTCAGTACTTTGGGTTTGAGAATTCATTGACTGATAGTTTAAAAACCTAAAAAACACTTCTCAGCTTGGTATTTGGAGAGAGCAACTATTCAAACATTTGG
CTTTTGATAATCATGGTCAGTTGTCAGAGGTCTGAGCAGTCCAGGCTTTAACTCTAAACTTATGCAGTACAACCTCTTGCTCACCTATAATTGGAAAGAAAAAGCTAGATCTGTCTGCCT
AATCTCCATGGATTGTTCATTTTGTTGGCAGAACTCAGGAACTTGTTGCCTTGTCTGGCGCGCATACTCTGGGAAGTAAAGGGTTTGGGAATCCAACTGTCTTCGATAATGAATATTTCA
AGATTCTCATGGAAAAGCCATGGTTGTCCTCAG
GTGACAAATGGCATTTATATGGTATCAAATGGTTATGTGTATATATATTGAATTCATTGAAATAAATAGCAAGCAACTGAATCATCA
GAACCTATGAAGCATTGATGTTCTGAAATGGAAATCCATGTACCTACATGCCTAGAGTTTAGATGATTGTTGCAGAAAACTGTCAAGCAAGATTCGGCTCAGGATAATCTAGGCTGCAAA
TTGTTTATGCTTCAGTATTTATCTGGAATGATGACTCTTTCTGATAATAGAAGGCCCCTTTTTTTAGAATTTTATTCATATGATAATGGGAATCATAAAGAATAATTTCCTTTTTCTTAA
TGTCTTTAACCATGTTGTAGCATTTTATTTCTCTTTCATCTGCACAGGCAGCATGACTAGTATGGTTGGACTTCCCTCTGATAGGGCACTTGTTGAAGATGATGAATGTGTAGGGTATGG
TTTTCTTTGACCTTATGCTATTTAGATTCCTTTATTATGGTTTGGAACAACAACTCCTCCAATTTTATCCTGCTAGCTGAAAGGCAGAATTTTATTCTAGTTTTAGTTCACAAGTTATAG
TATCGTTGTTCTCAGGATTGACCTTCTTTCTAGTAATGAATTCTTCTTGAACAGATGGATATCAAAGTATGCTGAGGACCAGAGTTTATTTTTTGATGATTTCAAGAATGCCTATACTAA
ACTTGTTGACACTGGTGCAACTTGGAAGAAAGCATTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAGTAACACCGTCGCCGTCGATTGTTGGCTTCTCAGTTCCGGCGTTTCCTCCTTTACATCCACTTCCAAGTTGTACTTTCCGGCCAATTTTTCTCGAAAGCCACGCTTTGGTAGCAACA
CAATTCGAGCTTCCGCCACCACAAACGGTTCAA
GTGAAGGTGTTATTTACAAAGCGTTATTATGTGGAAGAAGAGCCTTACTATCTATGATTACCTTGCCTCTTGTTATGCCGTGTGAAA
GAATTGACAATAGTGTTGGTGCCATTGCTGCTGA
TGAGAGCTTTCAGGTAAGGGAAGAGATCAGGAAGGTATTATCCAAGAGCAAGGCTGCTGGTGTACTTCGCCTTGTATTCCATGATG
CAGGAACTTTTGAAATTGATGAGAAAACTG
GGGGTATGAATGGCTCTATAGTATATGAACTCGACAGACCCGAAAACAAAGGCCTTAAGAAATCTCTAAAGATTCTGGACAAAGCGAAGA
GTCAAATTGATCTTGTGCAATCAG
TCTCATGGGCTGATATAATAGCTTTGGCTGGAGCTGAAGCTGTTTCATTATGTGGTGGACCTAGTATCCCCATTCAGTTGGGAAGAATTGATTCAA
T
GGTGCAAGATCCTGAAGGAAAACTTCCTGAAGAATCACTAGATGCCATTAGCTTGAAGCAATGTTTTGAAAGGAAAGGCTTCTCAACTCAGGAACTTGTTGCCTTGTCTGGCGCGCATA
CTCTGGGAAGTAAAGGGTTTGGGAATCCAACTGTCTTCGATAATGAATATTTCAAGATTCTCATGGAAAAGCCATGGTTGTCCTCAG
GCAGCATGACTAGTATGGTTGGACTTCCCTCTG
ATAGGGCACTTGTTGAAGATGATGAATGTGTAGG
ATGGATATCAAAGTATGCTGAGGACCAGAGTTTATTTTTTGATGATTTCAAGAATGCCTATACTAAACTTGTTGACACTGGTGCAA
CTTGGAAGAAAGCATTGTAG

Retrieve as FASTA