Entry information : GmPrx31 (Glyma11g30010.1)
Entry ID 519
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2011-10-12 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx31 (Glyma11g30010.1)
Name (synonym) GmPrx31 (Glyma11g30010.1)
Class Class III peroxidase    [Orthogroup: Prx062]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type Etiolated hypocotyls
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx31
start..stop
S start..stop
GmPrx327 589 0 1..329 1..328
InPrx73 486 1e-174 17..329 26..338
IaquPrx23 481 8e-173 25..329 29..333
PtPrx41 474 4e-170 7..329 3..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 30907080..30907316 237 N° 2 30908743..30908934 192 N° 3 30909933..30910101 169 N° 4 30911435..30911826 392
join(30907080..30907316,30908743..30908934,30909933..30910101,30911435..30911826 )


exon

Literature and cross-references GmPrx31 (Glyma11g30010.1)
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm11 (30907080..30911826)
Protein sequence: GmPrx31 (Glyma11g30010.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329
PWM (Da):   %s   36003.47  
PI (pH):   %s   10.31
Sequence 370
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALSPIRSSTFSSSSAIVTLAVLLLLTRTSSATLSKNFYSKTCPNVFNTVKSVVKSAVAKEPRIGASIVRLFFHDCFVQGCDGSILLDDTPTFQGEKTAAANNNSVRGYELIDDIKSKVEKICPGVVSCADILDIASRDSVVLLGGPFWNVRLGRRDSRSANFTAANTGVIPPPTSNLTNLITRFQDQGLSARDMVALSGAHTFGKARCTSFRDRIYNQTNIDRTFALARQRRCPRTNGTGDNNLANLDFRTPNHFDNNYFKNLLIKRGLLNSDQVLFNGGSTDSLVRTYSQNNKAFDSDFVKAMIRMGDIKPLTGSQGEIRKNCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCACTTTCTCCTATTCGTTCTTCTACTTTCTCTTCATCATCAGCTATTGTTACATTAGCTGTGTTACTTCTTCTTACAAGGACCTCTTCAGCTACCCTCTCAAAGAACTTCTATTCTA
AGACATGTCCAAACGTTTTCAACACGGTAAAATCTGTAGTAAAATCTGCTGTGGCCAAAGAACCTCGCATTGGAGCTTCTATTGTTCGCCTCTTCTTCCATGACTGCTTTGTTCAA
GTAA
TTTACTCCTAACCTTTATACTGGTGTTTTATTCCTGCTTAGACTAAGACTTTTTTTTAATAACTAATTAGATTAGTGCAGAGTATCAACNNNNNNNNNNNNNNNNNNNNNNTAAAAAAAA
TTTAAGTGAGCACTTTTAATAGGATTTCTCTTCCTGACTATATTTTTTCAAGATTAAAATATATTTTATGTTCCTATAATTTATCGCTTTTTAATTCATTTGTATCCCTATAATTTTTTT
TGTCTTCATCTTTGTAAAATGTATTTATTTTATGTTTTTTTAAGAACTTTAAATAACGTTTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATATATTTAAATTTTTTCGACTAAATTAGG
AGTTTTGCATGCCATAGATTTTTTTTTCATGAAGTAACTATCTATATTATTGAGCTACATATATAGCTCATCATTTTTTCAAAACTTTTTGGTTTCCATAATTTTGTCAGTTAAGATATC
ACTCGTGACAAGTACATATAACTTTCACTGATGTTTCGACTTTTAAAAATGCAAACGTTGTAAACCAATAACTAGACCTTTTTTCANNNNNNNNNNNNNNNNNNNNNNNNNTCTCTATCT
TAGTAAATCAATAGTTATATTTATCACTTTTTGTTACGTACCGATCGACTAATATAACACACAGACACTTGTACTGTAGATATAACGTTGCAAGGTGCGTTGATTTGACTCTACCAAATT
GATTTTGTCTTCTTTCAGCAGGAATGTTATACAAATATCAATAACGATAGCAGATAGTTCTCTGGTCAATATGTAGTATTTTTCATTCTTTTAAAAACCAAAACATATTAACTTTAAGTA
TATTTTTTTACTTCATGTTTTTTATAAATAATTATATAAATATCACATTATTTTAAAATATTTCTTTCTTTCAAATTTTTGTAAAAAAAAGTGAAAAAAAGCACATTTTTCAATTCAAAA
TTTTATGAACAGAAAATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCAAGTCGAAATAAATTATCCTAAGCTCATTCAAAAT
TATGCCCTATTTGTATAAGCTTCTATTACAAGCACGTATATGAAACTCTCGAGTAAACTAAAATTAGCTTATGTATATGAATTTAATAAGTTTTTTTTGGATAAATTAAAATTTTACTAA
TTCTTTTTCCTTCAAAACACATATGTTTAGATGTTTTGAATCGAATTTATGGTAATTCTTTGGTCATGTTTGATGGTTGATGCTGCTTTGATATGTAAACAGGGTTGTGATGGATCAATA
CTACTTGATGACACTCCAACCTTCCAGGGGGAGAAGACTGCAGCTGCTAACAACAATTCAGTGAGAGGTTATGAATTAATCGATGATATCAAGTCTAAGGTCGAGAAAATATGCCCCGGT
GTGGTCTCATGTGCTGATATCTTGGACATTGCTTCTCGTGACTCTGTTGTTCTT
GTGAGTTCAAACATAATTAATTAATCTGCTAAACAATATTGAGTTTAATAATCCTAGATCAGAAAT
AATTATTAGTATCAGTTTTAAGTTTTAAGATGATTATTATAAAAATCAACAACATTATCATGCATAATTACTTGTGATTAGATCCTAAGTGAAAAAGACCTTTACACTATTAGTATATAT
TATTTGTGTCTTTCAAAAACAAAGTATATATATCATTTGTTTTATTAATGTAATGTGTTAGTGAAGAGTTGCAATGTTTATATTAACAGTGTAGATCTATCTAAACAATATGATGCATCA
ATGATGTATATTATTAATTTCTTATATCAATAAAATTGTATATTAGTATGATCACCAATATAATAATACATACAACAATAAAGTTGAATCTAACAAAATGGATTAATTCCTCAAGTGATA
AATTAAAGTTTGAATTATATCGAAAGAGGCACTTATATTTAATGTCTATTCGCAAGAATGAATTCAGAAATATATCAAAGGGCATTAAATTTCTTTTTATANNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCAACTCAAAAGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNCCTCGTATATACATAATTGTGCTCCTTAGATCCTTTCTTGTATGTCTATATCTCAAACAAGATTATCTTAAAAAAATATACTTGTGAAAAACCAA
AAATATTAAGACTTATAATATTTATACTGATTATTCGATTTCCATTAAATAAAATTTATGCCAAAGAAGTTAAGTCTAATGATTATATATCATTAGCATATAAATTATATTTGTTTGTAG
TGTGATTTTGCAAACATAGTTGTTTCTGAACATCTATAGAAGTGCTTAAAATATTTATTTGTTATGTTGGTTTGTTTTGTTGCATTGTGCAGCTTGGAGGACCATTTTGGAATGTTAGAC
TTGGAAGAAGGGATTCTAGAAGTGCCAATTTCACTGCTGCAAACACTGGTGTTATTCCACCTCCCACATCTAACCTCACCAACCTTATCACAAGGTTTCAAGATCAAGGACTCTCTGCTA
GGGACATGGTTGCCTTATCTG
GTATTTTTCTCTTTTTTTTCTTCTTTATCTTATTATTATATATTCCCCATCTTTGATCTCTTCCTTCCATTATATGAACAATTACTACTTTTGTCTGTG
TTTAATTGAGACTTGAGACACGTTTTAATAACGGTTTTGTTTATAACAGTGAATTTTCCTAAACAAATTCATGCCCGAATGTGACATTTAAACAACCATGTGCATTGGATCAAGTCCTTT
TTTTTTCCAAGTTTGAAGTCATGTCTTTCAATAGTAACGCATTTAAGCAACCAGAAAGGCACATTTAACCAACTAAGAATCATCCATAATATTTCAATGTACGGGGAAATAAATGAATCT
AAGAACTCACTACCAGATTTCATAAGAGATATAAGGTGGGAGGTGAGTTGGGTAGTTAAGAGAAAAAGAAAGCAAAGAAACATCATGCATGGGTTTTATTTTCATATGTTAACAAACAAA
ATTAATAATTAACAACTAATATTTATTGATAAAAAAATCATATTTCATGTATGAACCTATGGTCAACTTAGTGGTGAAAGTTGGAGTAATTTGTACAGGATTTTAAATTCAAACTTTGTT
GTTGTCATTGTAAGAGAAAATTAAATTTCATATATAACTAGAAAATATGATTAACAAGCAGTTTCATATATCAACTAAAATTACAGCTACATTGTAATTTTAGGATTTAGTAACCTTGAT
CTATTGAGAGAGTCCTCCTTATATTTTATTATTTAATTTATACATTTATAAAAGTACGTAAACAATATGAATTTAATTAGAATGTAGTACAATACAAAGGTTTTTCTACATTGAAATCTA
AATATAAATTGTCATAAAAGACTTAAATATTTTTTGGTCCTTGTAATTTAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATCATTGCAAAATGTGTCTATTTT
ATTTTTCGTCCTTAAAATATTTTAAATAATGTTTCTTTTTATTATTAAAAATATTTTTTTATTGTTCAAAGAATTATCTAAAGCTCATTAAAAGTGATAAATAAAACAAATATATTTTGT
AAGTACTGAAATGAAAAAAAAATTACAACAACAAAAATAAAATAAAACTAAATTACAAGGATGAAAAAATATTTACATTGTCATTACATTGCATAGTAATTAAACTCATAATGTTAAAGG
GTTTTAGATTTTTAGTGCATGAATTAAACTTAATAATTATTAGTGTGACTAGAACTCCATTATGAGACAGACTTACCAACACGTACCAAATCAATTATTGAAAACTAATATTGAACAATT
CTATTTATGATATTTTGTGTGGTTTAACATGCAGGAGCTCACACATTTGGCAAAGCAAGGTGTACTAGTTTCAGAGATCGCATATACAATCAAACCAACATTGACAGAACATTTGCATTG
GCCAGGCAGAGGAGGTGCCCTAGGACCAATGGCACAGGTGACAACAATCTAGCAAATCTAGACTTCAGAACTCCAAATCATTTTGACAACAACTACTTCAAAAACCTTCTCATTAAAAGG
GGACTCCTCAATTCTGATCAAGTGCTTTTCAATGGTGGATCCACTGATTCACTGGTCAGAACATACAGCCAGAATAACAAGGCCTTTGATTCTGACTTTGTTAAAGCAATGATTAGGATG
GGAGATATCAAACCCTTAACTGGGTCACAAGGGGAGATTAGGAAGAACTGCAGGAGAGTGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCACTTTCTCCTATTCGTTCTTCTACTTTCTCTTCATCATCAGCTATTGTTACATTAGCTGTGTTACTTCTTCTTACAAGGACCTCTTCAGCTACCCTCTCAAAGAACTTCTATTCTA
AGACATGTCCAAACGTTTTCAACACGGTAAAATCTGTAGTAAAATCTGCTGTGGCCAAAGAACCTCGCATTGGAGCTTCTATTGTTCGCCTCTTCTTCCATGACTGCTTTGTTCAA
GGTT
GTGATGGATCAATACTACTTGATGACACTCCAACCTTCCAGGGGGAGAAGACTGCAGCTGCTAACAACAATTCAGTGAGAGGTTATGAATTAATCGATGATATCAAGTCTAAGGTCGAGA
AAATATGCCCCGGTGTGGTCTCATGTGCTGATATCTTGGACATTGCTTCTCGTGACTCTGTTGTTCTT
CTTGGAGGACCATTTTGGAATGTTAGACTTGGAAGAAGGGATTCTAGAAGTG
CCAATTTCACTGCTGCAAACACTGGTGTTATTCCACCTCCCACATCTAACCTCACCAACCTTATCACAAGGTTTCAAGATCAAGGACTCTCTGCTAGGGACATGGTTGCCTTATCTG
GAG
CTCACACATTTGGCAAAGCAAGGTGTACTAGTTTCAGAGATCGCATATACAATCAAACCAACATTGACAGAACATTTGCATTGGCCAGGCAGAGGAGGTGCCCTAGGACCAATGGCACAG
GTGACAACAATCTAGCAAATCTAGACTTCAGAACTCCAAATCATTTTGACAACAACTACTTCAAAAACCTTCTCATTAAAAGGGGACTCCTCAATTCTGATCAAGTGCTTTTCAATGGTG
GATCCACTGATTCACTGGTCAGAACATACAGCCAGAATAACAAGGCCTTTGATTCTGACTTTGTTAAAGCAATGATTAGGATGGGAGATATCAAACCCTTAACTGGGTCACAAGGGGAGA
TTAGGAAGAACTGCAGGAGAGTGAATTAA

Retrieve as FASTA