Entry information : GmPrx33 (Glyma11g07670.1) )
Entry ID 521
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx33 (Glyma11g07670.1) )
Name (synonym) GmPrx33 (Glyma11g07670.1) )
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Cotyledons
Etiolated hypocotyls
Hypocotyls
Roots
Roots hairs
Roots of 'Supernod' plants
Inducer Fusarium infection
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx33
start..stop
S start..stop
GmPrx102 672 0 1..331 1..331
MtPrx46 603 0 1..330 1..330
NtPrx86-1A 574 0 1..330 1..330
NnPrx50 573 0 1..330 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5364954..5365178 225 N° 2 5365409..5365600 192 N° 3 5365696..5365861 166 N° 4 5367132..5367544 413
join(5364954..5365178,5365409..5365600,5365696..5365861,5367132..5367544)


exon

Literature and cross-references GmPrx33 (Glyma11g07670.1) )
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm11 (5364954..5367544)
Protein sequence: GmPrx33 (Glyma11g07670.1) )
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332
PWM (Da):   %s   36319.71  
PI (pH):   %s   8.97
Sequence 373
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKSINFLLLLSLLAFVPSCHCKKKIGGYLYPQFYDGSCPRAQEIVQSIVAKAVAKEPRMAASLLRLHFHDCFVKGCDASVLLDSSGTIISEKRSNPNRDSARGFEVIDEIKSALEKECPHTVSCADILALAARDSTVLTGGPSWGVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLKGLDIVDLVALSGSHTIGNSRCTSFRQRLYNQTGNGKADFTLDQVYAAELRTRCPRSGGDQNLFVLDFVTPIKFDNFYYKNLLANKGLLSSDEILLTKNQVSADLVKQYAENNDLFFEQFAKSMVKMGNITPLTGSRGEIRKNCRGINK*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 12 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTGAAGTCTATAAACTTTCTCCTGCTTCTGTCTCTACTAGCCTTTGTTCCCTCCTGTCACTGCAAAAAGAAAATAGGAGGTTACCTCTACCCTCAATTTTACGACGGTTCATGCCCCA
GAGCTCAAGAGATTGTCCAATCCATCGTTGCCAAGGCTGTGGCAAAAGAACCCCGCATGGCTGCTTCGTTGCTCAGACTACATTTCCATGATTGTTTTGTCAAG
GTCTCTATATATAACA
GAAAACAAACTATCTTTATGCACCTAGTTGACACCTTTTATTCTCTATCTTTTTTTGTCACATTATATCACTTCTTACACTCCAATAACGGAGAGAATACGCATCTTTTGTGTGCTCATC
ACTTGTTACCTGTGTCTATGAGCACAAGTGTCCATGAATCATTTTTGTAGAACTTATATGGTTCAAATGCATGACTCGAGGTTTAATGTTTCAGGGCTGTGATGCATCGGTGTTGCTAGA
TAGCAGTGGAACTATTATCAGTGAGAAGAGGTCAAATCCGAACCGTGATTCAGCTCGAGGATTTGAAGTCATTGATGAAATTAAATCTGCACTAGAGAAGGAATGTCCACATACAGTGTC
ATGTGCTGACATTTTGGCTCTAGCTGCTAGAGATTCCACTGTTCTT
GTAAATATCTTCTTTTTATTTTGCACTCTGGTACCCTTATCTTGATATTTGACTATCAAAACTTAGTGATCAAG
CCTTATTTATAATCTCTGCAGACCGGTGGACCAAGCTGGGGAGTACCCTTGGGCAGAAGGGACTCTCTTGGTGCGAGTATTAGTGGCTCCAATAACAACATTCCTGCTCCCAACAACACA
TTTCAGACCATCTTAACTAAGTTCAAGCTTAAGGGGCTTGACATTGTTGATCTAGTTGCTCTATCTG
GTAGACTCCTAGTACTTTATCTGTTTATGGTCTATTACCTTCAAAGTTCAAAG
CATGTTGGTTTATGGTTATAGTTTCTTTAGATGACTATTTACAAATTTACTCCTTATTTCTTTACCGTTTTCAAAAATAATTTTATTTTCTAAAATTTATTTATCTCCTCAACATATTTA
GACGTGCTTATCTCATGAGCACATTTCTGTTTTGTAAAAGTTGATCCTATAAGAACTTGAACAGAGCATTTGAAGAACAAAAAAAAATTGTTTCTATTTTTTTTAGTTTTTTTAGCACTT
GTTTTATATATAATTTTCAAAAATTAATTAAGATGAAAAATTGATGGTTGTTTAGTATAAAATTATTTCAGAAAAGAAACTGAGAAATGAATAAAAAAACCCTAAATCTTACTTGAATTT
GATTTTACAAAATTAATTTTGGTTAAAATTGAGTTTAAAGCAAAATAATGTATATTTGAACACTTTACTTCAAAATCAAGTTTATTGTAAAATTAAAAAAATCAAATAAACACAATAATT
ACATAATTTTTTGTTAGTTAAAGATGCTTTAGGAATAAAATTGGTTTTATTTTGATGTAATCAAACAAATAATTTTTGCAAAACATAGCACTTCAAATGTAAGTGATATTCGCCTAAAAA
AATGTAAGCAAAGGAGTCTCAGTGCTCCACCTCCTCCACGTCCACGATCATGCAATGCGTCTCTGAAATAAAATCACTTCACGTTCAAAAAGAAGCAACAAAATGTGGCTTTTGTAGCAT
TTCTCTATTTTAACGTGATTTTGTTGCTTTGACACAGATCCAAAACGTGTTTCTAAACACGCCGTAAATTTAATTACATCGTCCTTTTTCGAGACTCTTTGCTCTCCAATTATGCAACTC
TAAATTTGATTACACCATCCACTTTTATTTTCTTGAGACCAGTATATGTTTGGATGAAAATTTGTAAATTCAATTTTAAATAAACTTGATTTTATAAAATTAATTGTGGTTTGGAGTGAA
GTGATATATATTTGAAAATTTGTATCTTAAAATCAGGTTTGTGTTAGCATTGTATGAAAAATTTAACCCAACGCAAAAGTTACTTTTGTTTTTCACTTTCAAACAAATGGGCTTTGGGAG
CAAACTTGATTATTTTAAAACTTGAAAATTTGTATCTTAAAATGAGTTTTTGACAAAATAGTACAATCAAACATGCTATTTTGTTGTGAAATCCCATTTGGACTATTTTAACGTGCGTTT
GATACTTTCAATTATAGGGAGCCACACTATAGGAAATTCCCGATGCACCAGCTTCAGGCAAAGACTATACAACCAAACAGGAAATGGAAAAGCAGACTTCACTCTTGATCAAGTGTATGC
TGCTGAATTGCGCACTAGGTGTCCAAGATCTGGTGGGGACCAGAATCTCTTTGTCCTAGACTTTGTTACCCCAATTAAATTTGACAACTTCTATTACAAGAACTTGTTGGCCAACAAGGG
TCTCTTAAGTTCTGACGAAATTCTCTTGACAAAGAATCAAGTATCAGCGGATTTAGTGAAGCAGTATGCAGAAAACAACGATCTTTTCTTTGAACAATTTGCCAAGTCCATGGTTAAGAT
GGGAAACATTACTCCTTTAACAGGGTCAAGGGGAGAGATCAGAAAGAACTGCAGAGGAATTAACAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTGAAGTCTATAAACTTTCTCCTGCTTCTGTCTCTACTAGCCTTTGTTCCCTCCTGTCACTGCAAAAAGAAAATAGGAGGTTACCTCTACCCTCAATTTTACGACGGTTCATGCCCCA
GAGCTCAAGAGATTGTCCAATCCATCGTTGCCAAGGCTGTGGCAAAAGAACCCCGCATGGCTGCTTCGTTGCTCAGACTACATTTCCATGATTGTTTTGTCAAG
GGCTGTGATGCATCGG
TGTTGCTAGATAGCAGTGGAACTATTATCAGTGAGAAGAGGTCAAATCCGAACCGTGATTCAGCTCGAGGATTTGAAGTCATTGATGAAATTAAATCTGCACTAGAGAAGGAATGTCCAC
ATACAGTGTCATGTGCTGACATTTTGGCTCTAGCTGCTAGAGATTCCACTGTTCTT
ACCGGTGGACCAAGCTGGGGAGTACCCTTGGGCAGAAGGGACTCTCTTGGTGCGAGTATTAGTG
GCTCCAATAACAACATTCCTGCTCCCAACAACACATTTCAGACCATCTTAACTAAGTTCAAGCTTAAGGGGCTTGACATTGTTGATCTAGTTGCTCTATCTG
GGAGCCACACTATAGGAA
ATTCCCGATGCACCAGCTTCAGGCAAAGACTATACAACCAAACAGGAAATGGAAAAGCAGACTTCACTCTTGATCAAGTGTATGCTGCTGAATTGCGCACTAGGTGTCCAAGATCTGGTG
GGGACCAGAATCTCTTTGTCCTAGACTTTGTTACCCCAATTAAATTTGACAACTTCTATTACAAGAACTTGTTGGCCAACAAGGGTCTCTTAAGTTCTGACGAAATTCTCTTGACAAAGA
ATCAAGTATCAGCGGATTTAGTGAAGCAGTATGCAGAAAACAACGATCTTTTCTTTGAACAATTTGCCAAGTCCATGGTTAAGATGGGAAACATTACTCCTTTAACAGGGTCAAGGGGAG
AGATCAGAAAGAACTGCAGAGGAATTAACAAGTGA

Retrieve as FASTA