Entry information : PblCcP01
Entry ID 5240
Creation 2007-08-29 (Christophe Dunand)
Last sequence changes 2007-08-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: PblCcP01
Name PblCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Mucoraceae Phycomyces
Organism Phycomyces blakesleeanus    [TaxId: 4837 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PblCcP01
start..stop
S start..stop
RoCcP02 478 3.09e-170 3..371 4..367
McirCcP02 468 2.83e-166 3..367 4..368
RoCcP01 412 3.05e-144 29..370 1..364
UramCcP02 401 5.09e-140 95..371 92..369
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '5240' 'complement(join(408228..408623,408702..408830,408888..409030,409108..409214,409272..409425,409473..409659))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 409473..409659 185 N° 2 409272..409425 152 N° 3 409108..409214 105 N° 4 408888..409030 141
N° 5 408702..408830 127 N° 6 408228..408623 394  
complement(join(408228..408623,408702..408830,408888..409030,409108..409214,4092 72..409425,409473..409659))


exon

Literature and cross-references PblCcP01
Literature unpublished, JOE genomic database
DNA ref. JGI genome:   scaffold_16 (409659..408228)
Protein sequence: PblCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   371 (305)
PWM (Da):   %s   41775.83 (32886.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.86 (9.09) Peptide Signal:   %s   cut: 30 range:30-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFLRSALKRIDSSRLVARSAITVSAASAIHSTRASILSAPRLGRG
YATDNKPSSNNNLLLFL
ESLSGMTALGGAAGYYYHNSEKSIKKDIPQKEKAIDYEKIYKEIADMLEDEDYDDGSYGPVLFRLSWHCSGTYDKKTDTGGSNGATRFLPESGHGANKGLDVARNLLDKVHAKHPEISYG
DLWTLGGVCAVQE
GGPTIPWRPGREDALTAKQCTPDGRLPDGMKKQDHIREIFYRMGFNDQEIVALVGGHTVGRCHLDRSGFEGPWNEAPTIFDNEYFTALVEREWVKKQLPSGIWQWVA
KENPDVMMLPAEIYMYNDKEFRKYFELYAKDQDKFFEDFAKAYKKLIELGVHFKDGDKEYKFKTVNV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTTACGTTCTGCATTAAAGCGTATTGACTCCTCACGCCTGGTAGCAAGATCGGCTATTACAGTCAGTGCTGCATCAGCAATCCATTCTACTCGCGCGAGTATTCTCTCTGCTCCA
AGACTTGGGCGTGGATATGCCACGGACAACAAGCCAAGCAGCAACAATAATCTCCTATTATTTCTAG
GTAATCTTTAATATTTTCCGGTAAAAAATTGCTATATACTAATAAAGAAAAAG
TCTTTCAGGAATGACTGCTCTTGGTGGTGCTGCTGGATACTACTACCACAACTCTGAGAAATCAATTAAAAAGGACATTCCTCAAAAAGAAAAGGCCATTGATTATGAGAAAATCTACAA
AGAGATTGCTGATATGCTGGAAGACGAAGA
GTAAGTCGATGCAATACTTTAAGAAAATTGGATGGCATTTAATATCGCATTCCTCAGTTTTACGATGATGGTTCCTACGGACCAGTGTTG
TTCCGCCTCTCCTGGCATTGTTCTGGAACATATGACAAAAAGACTGATACTGGTGGAAGCAATGGTGCAACTATGC
GTAAGAAAATGCAACTGTGTTTTAAAATTCCTAGTCAATTTTTA
CTTATGAGTTTTTTTTGTTGGTGTATATCTTAGGCGCTTTTTGCCTGAGTCAGGACACGGTGCCAATAAGGGTTTAGACGTTGCTCGTAATCTACTAGATAAGGTGCATGCAAAGCACCC
AGAAATTAGCTATGGAGATCTGTGGACTCTTGGAGGTGTCTGTGCTGTTCAGGAAATG
GTATGGTGCAAAGCATAACATTCTTGACGTACACATTACTTAATTGTGTTACATTAGGGGGC
GGCCCAACAATTCCCTGGAGACCAGGTCGCGAAGATGCTCTTACTGCCAAGCAATGCACGCCAGACGGTCGTCTCCCAGATGGCATGAAGAAACAAGATCATATCCGTGAGATATTCTAC
CGCATG
GTAATATTATATACTGATAAAGCATTATATTAGATAAAAAAAAAGATGTGTGTATTAATCAAATTATCTTTATTTTAGGGGGTTTTAATGACCAAGAGATTGTTGCTCTTGTTG
GTGGACACACAGTTGGTAGATGCCATCTTGACCGCAGTGGATTTGAGGGTCCATGGAACGAAGCCCCAACTATCTTCGATAATGAGTACTTTACAGCACTTGTGGAGCGAGAGTGGGTTA
AGAAACAACTTCCTTCTGGTATCTGGCAATGGGTCGCAAAAGAGAATCCAGATGTTATGATGCTTCCTGCAGAAATCTACATGTATAATGACAAAGAATTCCGGAAATACTTTGAATTGT
ATGCCAAAGATCAAGACAAGTTCTTTGAAGATTTCGCAAAGGCATACAAGAAACTTATTGAGCTCGGTGTTCACTTTAAGGATGGCGATAAGGAGTATAAGTTCAAGACTGTTAATGTAT
AA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTTACGTTCTGCATTAAAGCGTATTGACTCCTCACGCCTGGTAGCAAGATCGGCTATTACAGTCAGTGCTGCATCAGCAATCCATTCTACTCGCGCGAGTATTCTCTCTGCTCCA
AGACTTGGGCGTGGATATGCCACGGACAACAAGCCAAGCAGCAACAATAATCTCCTATTATTTCTAG
AAAGTCTTTCAGGAATGACTGCTCTTGGTGGTGCTGCTGGATACTACTACCAC
AACTCTGAGAAATCAATTAAAAAGGACATTCCTCAAAAAGAAAAGGCCATTGATTATGAGAAAATCTACAAAGAGATTGCTGATATGCTGGAAGACGAAGA
TTACGATGATGGTTCCTAC
GGACCAGTGTTGTTCCGCCTCTCCTGGCATTGTTCTGGAACATATGACAAAAAGACTGATACTGGTGGAAGCAATGGTGCAACTATGC
GCTTTTTGCCTGAGTCAGGACACGGTGCCAAT
AAGGGTTTAGACGTTGCTCGTAATCTACTAGATAAGGTGCATGCAAAGCACCCAGAAATTAGCTATGGAGATCTGTGGACTCTTGGAGGTGTCTGTGCTGTTCAGGAAATG
GGCGGCCCA
ACAATTCCCTGGAGACCAGGTCGCGAAGATGCTCTTACTGCCAAGCAATGCACGCCAGACGGTCGTCTCCCAGATGGCATGAAGAAACAAGATCATATCCGTGAGATATTCTACCGCATG
GGTTTTAATGACCAAGAGATTGTTGCTCTTGTTGGTGGACACACAGTTGGTAGATGCCATCTTGACCGCAGTGGATTTGAGGGTCCATGGAACGAAGCCCCAACTATCTTCGATAATGAG
TACTTTACAGCACTTGTGGAGCGAGAGTGGGTTAAGAAACAACTTCCTTCTGGTATCTGGCAATGGGTCGCAAAAGAGAATCCAGATGTTATGATGCTTCCTGCAGAAATCTACATGTAT
AATGACAAAGAATTCCGGAAATACTTTGAATTGTATGCCAAAGATCAAGACAAGTTCTTTGAAGATTTCGCAAAGGCATACAAGAAACTTATTGAGCTCGGTGTTCACTTTAAGGATGGC
GATAAGGAGTATAAGTTCAAGACTGTTAATGTATAA

Retrieve as FASTA