Entry information : Pgr1CysPrx01
Entry ID 5242
Creation 2007-05-25 (Christophe Dunand)
Last sequence changes 2012-04-03 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer Laure Collomb
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: Pgr1CysPrx01
Name Pgr1CysPrx01
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Fungi/Metazoa; Fungi; Basidiomycota; Basidiomycota
Organism Puccinia graminis f. sp. tritici    [TaxId: 56615 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pgr1CysPrx01
start..stop
S start..stop
Cque1CysPrx 333 7.81e-118 1..217 1..216
Hcy1CysPrx 313 3.98e-110 1..217 1..219
Athi1CysPrx01 307 1.41e-107 1..217 1..219
Pinv1CysPrx 306 4.03e-107 1..217 1..220
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '5242' 'join(127246..127499,127597..127726,127808..128077)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 127246..127499 252 N° 2 127597..127726 128 N° 3 127808..128077 268  
join(127246..127499,127597..127726,127808..128077)


exon

Literature and cross-references Pgr1CysPrx01
Literature Birren et al., Broad Institute. Unpublished, sequencing
DNA ref. JGI genome:   supercontig_2_93 (127246..128077)
Protein sequence: Pgr1CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   217 (293)
PWM (Da):   %s   24186.25 (30859.3)  
PI (pH):   %s   5.59 (8.21) Peptide Signal:   %s   cut: 0 range:Ymax-292
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSVRLGSVAPDFAAETTNGPVKSFHEWMADSWAILFSHPADFTPVCTTELGEVARRQKDFEARNTKVIGLSCNELTSHDDWItle='signal Peptide at pos 0'>KMPSVRLGSVAPDFAAETTNGPVKSFHEWMADSWAIL
FSHPADFTPVCTTELGEVARRQKDFEARNTKVIGLSCNELTS
HDDWIK
DINRVNSVQLSFPIIADSDRKIATLYDMLDEQDLTNRDSKGVPTVRSVFIVDPAKKVRLILQYPASTGRQFD
EIIRALDSLQLGDKHPVTTPANWTPGQPVIIHPSVSDQDAQNLFPNPIDHKTPYLRMTSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns). Strain="CRL 75-36-700-3".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCATCGGTCAGGTTAGGATCAGTTGCGCCGGACTTTGCGGCCGAAACGACGAATGGTCCGGTCAAGTCCTTCCACGAATGGATGGCCGATTCCTGGGCTATCCTGTTCTCTCATCCG
GCCGACTTCACTCCCGTCTGTACCACCGAGCTGGGCGAGGTTGCTCGAAGACAAAAGGACTTCGAGGCCCGGAACACTAAGGTCATCGGGCTGAGCTGTAACGAGCTCACGTCTCATGAC
GATTGGATCAAAGA
GAGTGCATTTGCGTCTTTGGCCTTTTTTCAATGTCGTGCTCTTGAAGCTGTGGCTAAGAATGTTCATGGTCTCCTCCTAACATACTCATCATTCTTTAGTATTAAC
CGCGTCAACTCGGTCCAATTGTCTTTTCCAATCATCGCCGATTCAGACCGGAAGATAGCCACTCTGTACGACATGTTGGATGAACAGGACCTCACTAACCGGGACAGCAAGGGCGTACCA
TTT
TTGTAAGTCACCCGAAAAAACCACGTTTGTTTTATTGTATCACGTCGGAAAAACTGAACCGACTTGCTGCTCCCCATATCCAGACTGTCCGATCGGTCTTCATCGTCGATCCCGCCA
AGAAGGTCAGATTGATCTTGCAATATCCCGCGTCGACCGGTCGACAATTTGACGAAATCATTCGCGCCTTGGATTCGCTCCAATTGGGTGACAAACATCCCGTCACCACTCCTGCTAATT
GGACCCCTGGTCAACCGGTCATCATCCACCCTTCAGTCTCCGACCAAGACGCTCAAAATCTCTTCCCTAACCCGATTGACCATAAGACTCCTTACCTCAGAATGACCTCCTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCATCGGTCAGGTTAGGATCAGTTGCGCCGGACTTTGCGGCCGAAACGACGAATGGTCCGGTCAAGTCCTTCCACGAATGGATGGCCGATTCCTGGGCTATCCTGTTCTCTCATCCG
GCCGACTTCACTCCCGTCTGTACCACCGAGCTGGGCGAGGTTGCTCGAAGACAAAAGGACTTCGAGGCCCGGAACACTAAGGTCATCGGGCTGAGCTGTAACGAGCTCACGTCTCATGAC
GATTGGATCAAAGA
TATTAACCGCGTCAACTCGGTCCAATTGTCTTTTCCAATCATCGCCGATTCAGACCGGAAGATAGCCACTCTGTACGACATGTTGGATGAACAGGACCTCACTAAC
CGGGACAGCAAGGGCGTACCATTT
ACTGTCCGATCGGTCTTCATCGTCGATCCCGCCAAGAAGGTCAGATTGATCTTGCAATATCCCGCGTCGACCGGTCGACAATTTGACGAAATCATT
CGCGCCTTGGATTCGCTCCAATTGGGTGACAAACATCCCGTCACCACTCCTGCTAATTGGACCCCTGGTCAACCGGTCATCATCCACCCTTCAGTCTCCGACCAAGACGCTCAAAATCTC
TTCCCTAACCCGATTGACCATAAGACTCCTTACCTCAGAATGACCTCCTTGTAA

Retrieve as FASTA