1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx40 (Glyma02g40010.1)
Entry ID 531
Creation 2006-01-18 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx40 (Glyma02g40010.1)
Name (synonym) GmPrx40 (Glyma02g40010.1)
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type Roots of 'Supernod' plants
Inducer Nodulation
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx40
start..stop		 S start..stop
MtPrx02 509 0 1..329 1..321
MtPrx70 507 0 1..329 1..321
MtPrx86 502 0 1..329 1..321
GmPrx13 499 5.96e-180 1..329 1..322
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx40 (Glyma02g40010.1)
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm02 (45211171..45208502)
Protein sequence: GmPrx40 (Glyma02g40010.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (304)
PWM (Da):   %s   36427.64 (33416.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.47 (7.44) Peptide Signal:   %s   cut: 27 range:27-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSHLQLSFLVLVMVTLATFMIPTFAQLTPNYYDKVCPKALPIIKSIVKQAIIREKRIGASLLRLHFHDCFVNGCDGSVLLDDTPSFLGEKTALPNLNSIRGFEVVDEIKVAVDKACNRP
VVSCADILAVAARDSVAILGGAQYWYQVLLGRRDAIYASKDAANANLPPPFFNFPQLLASFQSHGLDLKDLVVLSGGHTIGLAKCITFRDRIFNDTHIDPNFAATLRDSCPRRSGDGDTN
LTPLDASSPSQFDNTYYKALLHKKGLLHSDQELFKGGDDGGESDRLVQLYSYDPYAFARDFGVSMIKMGNLKPLTGYEGEIRYNCRKVNY*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 3 ESTs.
DNA ►
Send to BLAST
CDS►
Send to BLAST