1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx44 (Glyma18g44320)
Entry ID 535
Creation 2009-02-03 (Christophe Dunand)
Last sequence changes 2011-10-10 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx44 (Glyma18g44320)
Name (synonym) GmPrx44 (Glyma18g44320)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Germinating shoots
Roots
Roots of 'Supernod' plants
Inducer Auxin treatment
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx44
start..stop		 S start..stop
GmPrx46 633 0 1..322 1..322
PcoPrx01 544 0 1..322 1..321
GmPrx188 504 0 8..322 1..316
GmPrx52 501 0 8..322 1..316
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx44 (Glyma18g44320)
Literature Public Soybean EST Project. Vodkin,L.et al, A Functional Genomics Program for Soybean.
DNA ref. Phytozome 12:   Gm18 (54046942..54049459)
Protein sequence: GmPrx44 (Glyma18g44320)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (293)
PWM (Da):   %s   34294.57 (30927.9) Transmb domain:   %s   i5-27o
PI (pH):   %s   4.85 (4.60) Peptide Signal:   %s   cut: 30 range:30-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATTSFYMTIPIFKIRFFLFLCFFGIGSSQLSSDFYSTTCPNALS
TIKSVVDSAVSNEARMGASLLRLHFHDCFVQGCDASVLLNDTTSFTGEQTARGNVNSIRGFGVIDNIKSQVESLCPGVVSCADILAVAARDSVVALGGPSWTVQLGRRDSTTASLSSANSDLPRFDLSLQQLSDNFQNKGLTTAEMVALSG
GHTIGQAQCSTFRTRIYNETNIDSSFATSLQANCPSVGGDSNLAPLDSSQNTFDNAYFKDLQSQKGLLHTDQVLFNGGSTDSQVNGYASDPSSFNTDFANAMIKMGNISPLTGSSGEIRT
NCWKTN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from Phytozome (=> no splicing intron 1). No EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST