1. Browse the Database
  2. View Redoxidase
Entry information : PnoAPx-CcP01 (SNOG_15967 / PnoAPx-CcP01)
Entry ID 5360
Creation 2007-05-16 (Marcel Zamocky)
Last sequence changes 2012-02-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PnoAPx-CcP01 (SNOG_15967 / PnoAPx-CcP01)
Name (synonym) PnoAPx-CcP01 (SNOG_15967 / PnoAPx-CcP01)
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Phaeosphaeriaceae Phaeosphaeria
Organism Phaeosphaeria nodorum (Stagonospora nodorum)    [TaxId: 13684 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PnoAPx-CcP01
start..stop		 S start..stop
ClunAPx-CcP02 734 0 1..523 1..523
SturAPx-CcP02 720 0 1..531 1..530
AbraAPx-CcP 710 0 47..531 12..495
COsaAPx-CcP02 692 0 1..520 1..519
Gene structure Fichier Exons►


exon

Literature and cross-references PnoAPx-CcP01 (SNOG_15967 / PnoAPx-CcP01)
Literature Birren B.W., Lander E.S., Galagan J.E., Devon K., Nusbaum C., Jaffe D.B., Butler J., Alvarez P., Gnerre S., Grabherr M., Kleber M., Mauceli E.W., Brockman W., Rounsley S., Young S.K., LaButti K., Pushparaj V., DeCaprio D., Crawford M., Koehrsen M., Engels R., Montgomery P., Pearson M., Howarth C., Kodira C.D., Zeng Q., Yandava C., Alvarado L., Oleary S., Oliver R.O., Solomon P. Annotation of the Phaeosphaeria nodorum SN15 genome. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases.
Protein ref. UniProtKB:   Q0TWP9
DNA ref. JGI genome:   scaffold_42 (26869..25226)
Protein sequence: PnoAPx-CcP01 (SNOG_15967 / PnoAPx-CcP01)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   531 (513)
PWM (Da):   %s   57467.97 (55587.9)  
PI (pH):   %s   4.88 (4.81) Peptide Signal:   %s   cut: 19 range:19-531
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSSQIISLALLAPISQAYVWPSKYDDLDDLLYMQFGYVRNGQLS
DQVQSCDFGAKQPGVQKAAQWVRTAFHDAATYDATTKIGGLDASIQYELDRPENLGAALNSTLADISSLVTTRSSAADLLALSLVMSVARCANMRVPLRLGRKDATEAGIKGVPEAHTDLD
TSRKRFATMGMDEADMITLIACGHSIGGVNSVDHPEIVSGPVSPENKASFDTTKGAMDNQVVLEYLDNSTANPLIVNANDTLNSDKRIFAADGNATMRKLADKAYFKSKCENAFERMLNL
VPGDVTLSEPIEPADIRPFITQYALNANGSIEFSGRIRVRTTPVTGRDTNNLTASIILPSRSGSSPTEVVAKQATYKLGQTYGYLDEVFLWFEFKTVIPASAAISSFNIRVNDDVYDNAG
TGGYPVNPDVLYQAPQSCTFADPTTKQWSITMVAAVSKSLLQGGAEPQLNVVKKPRKPRSFLPELTPEIVKMEHAGKETAEYVYFTATTPLSTDGLDPRVDIEVGDSKVEYILTTALTQQ
KCAAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (no intron). No EST. Strain="SN15". Regions of the protein: 67-286 ascorbate peroxidase; up to pos. 531 unknown
DNA ►
Send to BLAST
CDS►
Send to BLAST