Entry information : CgAPx-CcP01 (CgHyBpox1)
Entry ID 5361
Creation 2007-05-16 (Marcel Zamocky)
Last sequence changes 2007-05-16 (Marcel Zamocky)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2015-03-04 (Marcel Zamocky)
Peroxidase information: CgAPx-CcP01 (CgHyBpox1)
Name (synonym) CgAPx-CcP01 (CgHyBpox1)
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium
Organism Chaetomium globosum    [TaxId: 38033 ]
Cellular localisation Secreted
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgAPx-CcP01
start..stop
S start..stop
HEC38APx-CcP02 331 2.23e-109 22..406 26..512
HCO27APx-CcP02 330 4.89e-109 22..406 25..511
ElaAPx-CcP1 326 1.92e-107 21..406 19..502
HC14APx-CcP03 320 5.18e-105 8..404 11..509
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '5361' 'complement(join(505927..506082,506169..506398,506578..506697,506924..506972,507057..507722))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 507057..507722 664 N° 2 506924..506972 47 N° 3 506578..506697 118 N° 4 506169..506398 228
N° 5 505927..506082 154  
complement(join(505927..506082,506169..506398,506578..506697,506924..506972,5070 57..507722))


exon

Literature and cross-references CgAPx-CcP01 (CgHyBpox1)
Literature Birren B.W., Lander E.S., Galagan J.E., Devon K., Nusbaum C., Ma L.-J., Jaffe D.B., Butler J., Alvarez P., Gnerre S., Grabherr M., Kleber M., Mauceli E.W., Brockman W., Rounsley S., Young S.K., LaButti K., Pushparaj V., DeCaprio D., Crawford M., Koehrsen M., Engels R., Montgomery P., Pearson M., Howarth C., Kodira C.D., Yandava C., Zeng Q., Alvarado L., Oleary S., Untereiner W.;
"Annotation of the Chaetomium globosum CBS 148.51 genome.";
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases.
Protein ref. GenPept:   EAQ87253 UniProtKB:   Q2H2X4
DNA ref. JGI genome:   scaffold_4 (507722..505927)
Protein sequence: CgAPx-CcP01 (CgHyBpox1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   406 (384)
PWM (Da):   %s   44412.91 (41914.5)  
PI (pH):   %s   5.87 (5.33) Peptide Signal:   %s   cut: 23 range:23-406
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLHSRLFLLHTLLLPFPSPTLAYTWPNPQTDILEAIYYQQIGYDG
RRFSAFVRTCETGNNLGAGRTNSAEWIRTAYHDMATADVEAGIGGMDASIGFERFRSENVGYHAFTDSLLFFADF
MSAYSSMADLIALGAVMSVTACTMSPNRKPLFLPFRGGRID
ATEPGPFGIPEPHHDLASHTNSFKKQGFNATEMIGLVACGHSLGGVNGRDFPTIVPVKNDS
KFDTSQSVLDNNMCVSNT
VPKGVQLSEVITPIPVKPDNLFITINDNGGMTIKGDIR
AWHPHAPSFEWWNFTTTVPVSQGLASFTVEVIDGSHSSIHDNGGNGFPLQTDLIPQTQLSCSAVYMGRAYMLNLTVVRDELN
FQDIKLTVPIPMRQAESMVPRFESHVLNMEKTGIIPATGYSLYTG*

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (4 introns). No EST available. Contig position: 28346-26554. Strain="ATCC 6205 / CBS 148.51 / DSM 1962 / IFO 6347 / NRRL 1970". Regions in the protein: 66-205 heme peroxidase domain; up to pos. 406 unknown function.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGCATTCAAGGCTCTTCCTCCTCCACACCCTCCTCCTTCCTTTTCCTTCTCCCACTTTGGCATACACCTGGCCAAATCCACAAACCGACATCTTAGAGGCTATATACTACCAACAG
ATTGGCTACGATGGACGTAGATTCAGCGCGTTCGTTAGAACATGCGAGACTGGGAATAACCTTGGAGCAGGACGAACCAACAGCGCAGAATGGATACGGACGGCTTATCACGATATGGCG
ACGGCGGACGTCGAGGCAGGTATCGGAGGGATGGATGCCAGCATCGGCTTTGAGAGGTTCCGCTCAGAGAACGTTGGTTATCACGCTTTTACCGACAGTCTTTTATTCTTCGCCGACTTC
ATGAGCGCGTATTCATCCATGGCCGACCTGATCGCCCTCGGCGCTGTCATGTCCGTTACCGCGTGCACCATGTCACCAAACCGGAAACCGCTCTTTTTACCATTCAGGGGGGGGAGAATC
GATGCTACGGAGCCCGGGCCCTTTGGTATCCCGGAACCACACCATGATCTCGCAAGCCACACGAATAGCTTTAAGAAGCAAGGCTTCAATGCCACCGAGATGATTGGTCTTGTGGCTTGC
GGCCATAGTCTAGGCGGTGTCAATGGACGTGACTTCCCAACGATTGTTCCGGTCAAGAATGACTCG
GTAGGTGTCGACTCCGGCAACCACAAGGTAACGGGACGAGGGGCTTCTCTAATA
GATGGGTAGACCAATGTCGACAGCAAACAGAAAAATTTGACACCAGCCAGTCGGTGCTCGACAACAACATGTGTGTTTCAAGTAAACCGTGTGTTGTTCAAGACCGCGTGCTGACCCCTG
AGTGAACGCAGAGCAATTGAGTTCCTCAAAAACGGTACCCAAAATGCACTGGCATTCGGGCCCAACAAAACCACGAGGTCTGATCACCGTATCTTCAGCTCGGATGGGGGCGCTTTGATT
AAAAAGCTCGCCTCATCCCAGGATTACTTTTTGGAAACTTGCACTGAGCTGTTTACCCGCATGATAGACACACTGTACCAAAAGGGGTTCAGTTGTCCGAAGTTATCACGCCTATCCCCG
TGAAGCCAGACAATCTCTTTATCACGATAAATGACAACGGTGGCATGACCATCAAGGGGGATATAAGGG
GTATACATCCTCACCCACTCCTAGGCCACATCACAATCAGCTAATCTGGTC
CCAGATACGCACCGATGACAACTCTCCCACCGACTCCCGCTTGGTCCTCGTACATTTTAAACCAAGAGCCTCCGGGGCACCGGCCATTCCACCGGTAGCAGCCGTCAGGCTAGCCAAAAC
CACCACAGCCCCTGGCACCCCCATGCGCCCTCCTTCGAATGGTGGAATTTCACGACAACCGTCCCCGTCAGCCAGGGTCTCGCCTCCTTCACCGTCGAGGTCATCGACGGCAGTCACTCC
TCAATACACGACAATGGCGGAAACGGCTTCCCATTACAAACAGACCTCATACCCCAAACTCAGCTGTCCTGTAGCGCCGTGTACATGGGAAGAGCCTACATGCTCAATCTGACCGTGGCG
GTGAGTCCCTGAAAGCTTTCCAGCACAACAGAAACGACCCTAAATTTCCACATTTACTGACTTCTCCACGCGTGCACTCCGTACAGGTGTCCGAGACGAGCTCAACTTCCAAGATATTAA
ACTCACCGTCCCGATCCCCATGCGGCAAGCCGAGTCCATGGTGCCCCGGTTTGAGTCGCATGTTCTCAACATGGAGAAGACGGGGATCATTCCAGCCACTGGATACTCGCTGTATACGGG
CTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGCATTCAAGGCTCTTCCTCCTCCACACCCTCCTCCTTCCTTTTCCTTCTCCCACTTTGGCATACACCTGGCCAAATCCACAAACCGACATCTTAGAGGCTATATACTACCAACAG
ATTGGCTACGATGGACGTAGATTCAGCGCGTTCGTTAGAACATGCGAGACTGGGAATAACCTTGGAGCAGGACGAACCAACAGCGCAGAATGGATACGGACGGCTTATCACGATATGGCG
ACGGCGGACGTCGAGGCAGGTATCGGAGGGATGGATGCCAGCATCGGCTTTGAGAGGTTCCGCTCAGAGAACGTTGGTTATCACGCTTTTACCGACAGTCTTTTATTCTTCGCCGACTTC
ATGAGCGCGTATTCATCCATGGCCGACCTGATCGCCCTCGGCGCTGTCATGTCCGTTACCGCGTGCACCATGTCACCAAACCGGAAACCGCTCTTTTTACCATTCAGGGGGGGGAGAATC
GATGCTACGGAGCCCGGGCCCTTTGGTATCCCGGAACCACACCATGATCTCGCAAGCCACACGAATAGCTTTAAGAAGCAAGGCTTCAATGCCACCGAGATGATTGGTCTTGTGGCTTGC
GGCCATAGTCTAGGCGGTGTCAATGGACGTGACTTCCCAACGATTGTTCCGGTCAAGAATGACTCG
AAATTTGACACCAGCCAGTCGGTGCTCGACAACAACATGTGTGTTTCAAACACT
GTACCAAAAGGGGTTCAGTTGTCCGAAGTTATCACGCCTATCCCCGTGAAGCCAGACAATCTCTTTATCACGATAAATGACAACGGTGGCATGACCATCAAGGGGGATATAAGGG
CCTGG
CACCCCCATGCGCCCTCCTTCGAATGGTGGAATTTCACGACAACCGTCCCCGTCAGCCAGGGTCTCGCCTCCTTCACCGTCGAGGTCATCGACGGCAGTCACTCCTCAATACACGACAAT
GGCGGAAACGGCTTCCCATTACAAACAGACCTCATACCCCAAACTCAGCTGTCCTGTAGCGCCGTGTACATGGGAAGAGCCTACATGCTCAATCTGACCGTGGCG
GTCCGAGACGAGCTC
AACTTCCAAGATATTAAACTCACCGTCCCGATCCCCATGCGGCAAGCCGAGTCCATGGTGCCCCGGTTTGAGTCGCATGTTCTCAACATGGAGAAGACGGGGATCATTCCAGCCACTGGA
TACTCGCTGTATACGGGCTAG

Retrieve as FASTA