Entry information : RoKat01
Entry ID 5368
Creation 2007-05-16 (Marcel Zamocky)
Last sequence changes 2007-05-16 (Marcel Zamocky)
Sequence status complete
Reviewer Laure Collomb
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: RoKat01
Name RoKat01
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Fungi Mucoraceae Rhizopus
Organism Rhizopus oryzae    [TaxId: 64495 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RoKat01
start..stop
S start..stop
PblKat01 825 0 1..484 1..484
CowKat01 706 0 6..482 4..481
PpalKat01 667 0 1..477 1..480
NgrKat01 644 0 4..477 11..484
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1608522..1608607 86 N° 2 1608427..1608461 35 N° 3 1608264..1608335 72 N° 4 1607980..1608210 231
N° 5 1607496..1607926 431 N° 6 1607175..1607433 259 N° 7 1606776..1607116 341  
complement(join(1606776..1607116,1607175..1607433,1607496..1607926,1607980..1608 210,1608264..1608335,1608427..1608461,1608522..1608607))


exon

Literature and cross-references RoKat01
Literature unpublished
DNA ref. JGI genome:   supercontig_3.7 (1608607..1606776)
EST ref. GenBank:   EE008471 [5' end]   EE009653 [3' end]   EE010040 [Fragment]
Protein sequence: RoKat01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   484
PWM (Da):   %s   54459.28  
PI (pH):   %s   7.42
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKNVLTTSNGNPVENNQTSQTAGAWGPVLIQDFHLVDKAHFDRERIPERVVHAKGAGAHGVFEVTNDITHLTKAKFLSHVGKTTPVFLRFSTVGGEKGSADTARDPRGFALKFYTEEGNWDMVGNNTPVFFIRDPSKFPDFIHTQKRNPRTNYADPDAFWDFLSLVPESIHQVTILFSNRGTPDGYRHLNGYSSHTLKLVNDKGEFKYVKWHFKTDQGIKNLTAQKAGELAGSDPDYATRDLFNAIERGDYPSWSVYIQVMNPEDAKKYRFNPFDVTKVWSHDYPLQPVGKLTLNRNPENYFAETEQAAFSPSHIVPGIDVSPDRMLQGRLFSYPDTHRHRLGVNYAQIPINQPQCRVSNHQRDGQMAVLGNGGSAPNYEPNSFSGPQQTNIAATTFTAEELEGVTGRHSFTLTDDDFVQAGDLYRLMSAEEKTDLINNIARHLKNAKKHIQERQIGHFKRADPEYGQRIEQTILALSSKA

Retrieve as FASTA  
Remarks Complete from genomic (6 introns) and 11 ESTs (5' end: EE008471, EE007675, EE008233, EE007541, EE006068, EE004840, EE000590; middle: EE010040; 3'end: EE009653, EE005868, EE003058). Strain="RA 99-880"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCAAGAACGTTCTTACTACATCCAATGGTAATCCTGTCGAAAACAACCAAACATCTCAAACTGCTGGTGCCTGGGGACCTGTGTAGGTTATTTTAAAGTACGCGTCTTGATGATCA
ACATATTAAACTTTTTATGTCTATAGCCTTATTCAAGATTTTCATTTAGTTGATAAACTTGGTGAGTAAAAAAAAAATATCCTGCAAATGGACGTTACTTGTCCTACATTTCTATTTTTG
GTTATTATTTGCTGACACTTTTTTTTCTCAAGCTCACTTTGACAGAGAACGTATTCCTGAGCGTGTGGTTCATGCAAAAGGTGCTGGTGCACACGGTGTTTTTGGTATGTGAAATATGAT
TAGTTCTTGTGCTTTACTTATCGTTTAACCAATTTAGAGGTTACTAATGACATCACTCATCTCACCAAGGCCAAGTTTTTGAGTCATGTTGGTAAAACAACTCCAGTCTTTCTTCGATTC
TCAACTGTTGGTGGTGAAAAAGGTAGTGCTGATACTGCTCGTGATCCTCGCGGTTTTGCTTTAAAATTTTATACTGAAGAAGGCAATTGGGATATGGTTGGCAATAATACCCCAGTCTTC
TTTATTCGTGATCCTTCCAAGTTCCCAG
GTACACATAAAATAAAGTTTCCCTATTATCATATAGCTAATGAGTTTTTATAGACTTTATTCACACTCAAAAAAGAAACCCTAGAACCAACT
ATGCTGATCCAGATGCCTTTTGGGATTTCCTTTCCCTTGTTCCCGAGTCAATTCATCAAGTCACCATTCTTTTCTCCAACAGAGGTACACCTGATGGTTACCGCCATCTCAATGGCTACT
CCTCTCACACTCTCAAGTTGGTCAACGATAAGGGCGAGTTCAAGTACGTTAAATGGCACTTCAAGACCGATCAAGGCATCAAGAATCTCACAGCCCAAAAGGCTGGTGAACTTGCTGGCT
CTGATCCAGACTACGCCACACGCGACCTTTTCAATGCCATTGAACGCGGTGATTATCCTTCTTGGTCTGTTTATATCCAAGTCATGAACCCTGAAGATGCCAAAAAGTATCGCTTCAATC
CTTTCGACGTTACCAAAGTTTGGTCACACAAG
GTATAAACAATCTGTGGTTTTATATCACAAATTTTTCTCACATACACAAAATTCTTCTTCAGGATTATCCTCTTCAACCTGTGGGCAA
ACTTACATTGAACCGTAACCCTGAAAACTACTTTGCTGAGACTGAGCAAGCTGCCTTCTCTCCTTCTCATATTGTACCTGGTATTGATGTTTCTCCTGATCGTATGTTGCAAGGCCGTCT
CTTTTCTTACCCTGATACTCACCGTCATCGTCTTGGTGTGAACTATGCACAGATTCCTATTAACCAACCCCAGTGCCGTGTCTCTAATCATCAGCGTGATGGTCAAATGGCTG
GTACGTT
TTTTATTTTTATTTTTTTGCATTATAATTCTGAAAAACAAACCTGTTATAGTTTTGGGCAATGGTGGATCTGCTCCTAATTATGAACCCAACTCATTCAGTGGACCTCAACAAACCAATA
TTGCCGCTACTACTTTTACCGCTGAAGAACTTGAAGGCGTCACTGGCCGTCATAGTTTTACCTTGACCGACGATGACTTTGTACAAGCTGGTGACTTGTATCGTCTCATGTCTGCTGAAG
AAAAGACTGATTTGATCAACAATATCGCCAGGCACTTGAAGAATGCCAAGAAGCATATCCAAGAGCGCCAAATTGGTCACTTTAAGCGTGCTGATCCAGAATATGGTCAAAGAATTGAGC
AGACTATTTTGGCTTTGAGCTCAAAAGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCAAGAACGTTCTTACTACATCCAATGGTAATCCTGTCGAAAACAACCAAACATCTCAAACTGCTGGTGCCTGGGGACCTGTCCTTATTCAAGATTTTCATTTAGTTGATAAACTT
G
CTCACTTTGACAGAGAACGTATTCCTGAGCGTGTGGTTCATGCAAAAGGTGCTGGTGCACACGGTGTTTTTGAGGTTACTAATGACATCACTCATCTCACCAAGGCCAAGTTTTTGAGT
CATGTTGGTAAAACAACTCCAGTCTTTCTTCGATTCTCAACTGTTGGTGGTGAAAAAGGTAGTGCTGATACTGCTCGTGATCCTCGCGGTTTTGCTTTAAAATTTTATACTGAAGAAGGC
AATTGGGATATGGTTGGCAATAATACCCCAGTCTTCTTTATTCGTGATCCTTCCAAGTTCCCAG
ACTTTATTCACACTCAAAAAAGAAACCCTAGAACCAACTATGCTGATCCAGATGCC
TTTTGGGATTTCCTTTCCCTTGTTCCCGAGTCAATTCATCAAGTCACCATTCTTTTCTCCAACAGAGGTACACCTGATGGTTACCGCCATCTCAATGGCTACTCCTCTCACACTCTCAAG
TTGGTCAACGATAAGGGCGAGTTCAAGTACGTTAAATGGCACTTCAAGACCGATCAAGGCATCAAGAATCTCACAGCCCAAAAGGCTGGTGAACTTGCTGGCTCTGATCCAGACTACGCC
ACACGCGACCTTTTCAATGCCATTGAACGCGGTGATTATCCTTCTTGGTCTGTTTATATCCAAGTCATGAACCCTGAAGATGCCAAAAAGTATCGCTTCAATCCTTTCGACGTTACCAAA
GTTTGGTCACACAAG
GATTATCCTCTTCAACCTGTGGGCAAACTTACATTGAACCGTAACCCTGAAAACTACTTTGCTGAGACTGAGCAAGCTGCCTTCTCTCCTTCTCATATTGTACCT
GGTATTGATGTTTCTCCTGATCGTATGTTGCAAGGCCGTCTCTTTTCTTACCCTGATACTCACCGTCATCGTCTTGGTGTGAACTATGCACAGATTCCTATTAACCAACCCCAGTGCCGT
GTCTCTAATCATCAGCGTGATGGTCAAATGGCTG
TTTTGGGCAATGGTGGATCTGCTCCTAATTATGAACCCAACTCATTCAGTGGACCTCAACAAACCAATATTGCCGCTACTACTTTT
ACCGCTGAAGAACTTGAAGGCGTCACTGGCCGTCATAGTTTTACCTTGACCGACGATGACTTTGTACAAGCTGGTGACTTGTATCGTCTCATGTCTGCTGAAGAAAAGACTGATTTGATC
AACAATATCGCCAGGCACTTGAAGAATGCCAAGAAGCATATCCAAGAGCGCCAAATTGGTCACTTTAAGCGTGCTGATCCAGAATATGGTCAAAGAATTGAGCAGACTATTTTGGCTTTG
AGCTCAAAAGCTTAA

Retrieve as FASTA