Entry information : NhaeCP02 (NhaeKatG2)
Entry ID 5374
Creation 2007-05-16 (Marcel Zamocky)
Last sequence changes 2011-05-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-24 (Catherine Mathe (Scipio))
Peroxidase information: NhaeCP02 (NhaeKatG2)
Name (synonym) NhaeCP02 (NhaeKatG2)
Class Catalase peroxidase    [Orthogroup: CP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Nectria
Organism Nectria haematococca    [TaxId: 140110 ]
Cellular localisation Secreted
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NhaeCP02
start..stop
S start..stop
FoCP03 1283 0 9..781 6..776
FoCP02-1 1280 0 9..781 6..776
FoCP04 1274 0 9..781 6..776
GmoCP02 1261 0 9..781 6..776
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '5374' 'complement(join(13148..14399,14451..14586,14638..15069,15122..15194,15244..15398,15455..15755))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15455..15755 299 N° 2 15244..15398 153 N° 3 15122..15194 71 N° 4 14638..15069 430
N° 5 14451..14586 134 N° 6 13148..14399 1250  
complement(join(13148..14399,14451..14586,14638..15069,15122..15194,15244..15398 ,15455..15755))


exon

Literature and cross-references NhaeCP02 (NhaeKatG2)
Literature [1] Zamocky, M.; Furtmüller, P.G.; Obinger, C. (2009) Two distinct groups of fungal catalase/peroxidases Bioch. Soc. Trans. 37: 772-777
[2] Coleman, J.J.; Rounsley, S.D.; Rodriguez-Carres, M.; Kuo, A.; Wasmann, C.C., Grimwood, J.; Schmutz, J.; Taga, M.;;van Etten, H.D. (2009) The genome of Nectria haematococca: contribution of supernumerary chromosomes to gene expansion. PLoS Genet. 5: E-1000618
Protein ref. UniProtKB:   C7ZIK0
DNA ref. JGI genome:   sca_41_chr12_2_0 (15755..13148)
Protein sequence: NhaeCP02 (NhaeKatG2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   782 (761)
PWM (Da):   %s   85690.65 (83617.5)  
PI (pH):   %s   6.72 (6.67) Peptide Signal:   %s   cut: 22 range:22-782
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHGISSAWLLLASGVLPLVAGDGCPFAKRATDSGSDLFPPREIAE
DFGRCRVAGNAAGAGTRSRDFWPCQLRLDVLRQFSPQINPLGEEFDYVEAFKTLD
YEALKKDLHSLITDSQDWWPADFGHYGGLFIRMAWHSAGTYRAIDGRGGGGGQQRFAPLNSWPDNQNLDKARRLLWPIKQKYGNKISWADLILLAGNVALESMDFEPIGFGAGRADTWQS
DESVYWGAETTFVPKGNDVRYNGSKDVVDRADKLEKPLGAVSLGLIYVNPEGPDANSNPADSALDIRVNFDRMGMNDEETVALIVGGHTFGKTHGAVPG
SNIGPEPEAADLGEMGLGWHN
KVGEGNGPNQMTSGLEVIWTKTPT
KWSNGFLTSLLTNNWTLVESPAGAHQWEALNGTVDYPDPFDKTKFRRATMLTSDLALIHDPEYLKICKRWQKNPEELRKAFGRAWFKLLHRDLGPV
SRYQGPEVPKEKFTWQDPLPERKGDVIGDDDIATLKAELLAAKGLGVSKLVSTAWNAASTFRNSDKRGGANGARIALKPQRSWASNNPEQLEQVLSALKAIQKKFNSGYKTKQVSLADLI
VLGGVAAVEKAAHDAGFKDIKVPFTPGRVDATQDQTDVRSFGFLEPIADGFRNYGHGTARARTEELLVDKAALLTLTPPELTVLVGGLRALNANFDGSSKGILTTKKGQLTNDFFVNLLD
AATVWTKQDSQGELWTGTDRKTKAKKWTATRADLVFGSHAELRAISEVYGSADAKEKFVKDFVATWDKVMNLDRFDVKAKN

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). Anamorph Fusarium solani subsp. pisi, strain="77-13-4/FGSC 9596/MPVI".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACGGCATCTCTTCAGCTTGGCTGTTGCTGGCCTCGGGGGTCCTGCCTCTTGTGGCTGGTGACGGCTGTCCCTTTGCCAAGAGGGCCACCGACTCTGGTTCTGACTTGTTCCCTCCA
AGGGAGATTGCCGAAGATTTTGGACGATGCCGTGTCGCCGGTAATGCTGCCGGTGCTGGTACTCGAAGCCGGGACTTTTGGCCCTGCCAGTTAAGGCTCGATGTGCTGCGTCAGTTCTCG
CCTCAGATTAACCCATTGGGCGAGGAGTTTGACTATGTGGAGGCGTTCAAGACGCTTGACT
GTGAGTTGCAGATCTTGTGTATCTGAAACCGCCGAGACTATGCTAACGTGGGATAGATA
TGAGGCTCTGAAGAAGGATCTGCACAGCCTCATCACTGATTCACAGGATTGGTGGCCCGCTGACTTTGGCCATTATGGAGGTCTGTTTATCCGTATGGCTTGGCACAGCGCTGGTACCTA
CCGCGCCATTGACGGTCGTGGCGGTGGTGGCATG
GTGAGTTATGCCTACGAGCCAATACGGCTATTCGCTAACAATCGCCCAGGGGGTCAACAGCGATTTGCCCCTCTCAACAGCTGGCC
CGATAACCAGAACCTTGACAAGGCCCGCCGTCTTCTCT
GTGAGTCCCTGAAGCTACTCAATTAAGTAACATTGTACTCATAAGTCTCCAGGGGGCCCATCAAGCAAAAGTATGGCAACAA
GATCTCTTGGGCCGATCTCATCCTCCTCGCCGGCAACGTCGCCCTCGAGTCCATGGACTTTGAGCCCATTGGCTTTGGCGCTGGCCGTGCCGACACCTGGCAATCTGACGAATCCGTCTA
CTGGGGTGCAGAGACCACATTTGTCCCCAAGGGCAACGACGTCCGCTACAACGGCAGCAAGGACGTTGTCGATCGTGCTGACAAGCTCGAGAAGCCTCTTGGGGCTGTCTCTCTGGGCCT
TATCTATGTGAACCCCGAGGGACCTGATGCTAACTCTAACCCTGCTGATTCCGCTTTGGATATTCGTGTCAACTTTGACCGTATGGGTATGAACGATGAGGAGACTGTTGCTCTCATTGT
TGGTGGTCACACCTTTGGCAAAACCCACGGCGCTGTTCCTGGTT
GTGAGTTTCTCCCGGTTCAATGAGAAATTAGCTGAATGCTAACTTGAATAGCCCCAACATTGGTCCCGAGCCCGAG
GCTGCTGACCTTGGTGAGATGGGCCTGGGATGGCACAACAAGGTCGGTGAGGGTAACGGCCCCAACCAGATGACCAGTGGACTTGAGGTCATCTGGACCAAGACCCCTACCAA
GTAAGTT
TGATGAAACTTCAACCAGAATCCTCAGTTACTGACTCAAATCAGGTGTGGAGCAACGGCTTCCTCACCAGTCTTCTCACCAACAACTGGACCCTCGTCGAGAGCCCTGCTGGCGCCCATC
AATGGGAAGCCCTCAACGGCACAGTCGACTACCCCGATCCCTTTGACAAGACCAAGTTCCGCCGCGCCACCATGCTGACTAGCGACCTTGCTCTCATCCACGACCCTGAGTACCTCAAGA
TCTGCAAGCGCTGGCAGAAGAACCCCGAGGAGCTCCGCAAGGCATTTGGCCGCGCCTGGTTCAAGCTTCTCCACCGTGATCTTGGCCCCGTTTCTCGCTACCAGGGCCCTGAGGTTCCTA
AGGAGAAGTTTACTTGGCAAGATCCTCTTCCCGAGCGCAAGGGTGATGTCATTGGTGATGATGATATTGCCACTCTGAAGGCTGAGCTGCTTGCTGCCAAGGGTCTTGGTGTTTCCAAGC
TTGTTTCCACCGCTTGGAATGCTGCTTCCACCTTCCGTAACTCCGATAAGCGTGGTGGTGCCAACGGTGCTCGCATTGCTCTTAAGCCTCAGCGCAGCTGGGCTAGCAACAACCCTGAGC
AGCTTGAGCAGGTTCTTAGCGCCCTCAAGGCCATACAGAAGAAGTTCAACTCTGGATACAAGACCAAGCAGGTTTCCCTGGCTGATCTGATCGTCCTCGGTGGTGTTGCCGCCGTCGAGA
AGGCTGCTCACGATGCTGGTTTCAAGGATATCAAGGTCCCTTTCACCCCTGGTCGTGTCGACGCCACTCAGGACCAGACTGATGTCCGATCTTTCGGTTTCCTCGAGCCTATTGCTGACG
GATTCCGCAACTACGGCCATGGAACCGCTCGCGCCCGTACCGAGGAGCTCCTTGTCGATAAGGCGGCCCTCCTCACCCTGACTCCTCCCGAGCTGACCGTCCTCGTCGGCGGTCTCCGCG
CCCTCAACGCCAACTTTGACGGCTCTTCAAAGGGTATTCTCACCACCAAGAAGGGCCAGCTCACCAATGACTTCTTTGTCAACCTCCTCGACGCCGCCACGGTTTGGACCAAGCAGGACT
CCCAGGGTGAGCTCTGGACCGGCACCGACCGCAAGACTAAGGCCAAGAAGTGGACTGCTACTCGTGCTGATCTTGTCTTTGGATCACACGCCGAGCTTCGGGCCATTTCCGAGGTTTACG
GCAGCGCGGATGCCAAGGAGAAGTTTGTCAAGGACTTTGTTGCCACTTGGGACAAGGTCATGAACTTGGACCGTTTTGATGTCAAGGCCAAGAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACGGCATCTCTTCAGCTTGGCTGTTGCTGGCCTCGGGGGTCCTGCCTCTTGTGGCTGGTGACGGCTGTCCCTTTGCCAAGAGGGCCACCGACTCTGGTTCTGACTTGTTCCCTCCA
AGGGAGATTGCCGAAGATTTTGGACGATGCCGTGTCGCCGGTAATGCTGCCGGTGCTGGTACTCGAAGCCGGGACTTTTGGCCCTGCCAGTTAAGGCTCGATGTGCTGCGTCAGTTCTCG
CCTCAGATTAACCCATTGGGCGAGGAGTTTGACTATGTGGAGGCGTTCAAGACGCTTGACT
ATGAGGCTCTGAAGAAGGATCTGCACAGCCTCATCACTGATTCACAGGATTGGTGGCCC
GCTGACTTTGGCCATTATGGAGGTCTGTTTATCCGTATGGCTTGGCACAGCGCTGGTACCTACCGCGCCATTGACGGTCGTGGCGGTGGTGGCATG
GGTCAACAGCGATTTGCCCCTCTC
AACAGCTGGCCCGATAACCAGAACCTTGACAAGGCCCGCCGTCTTCTCT
GGCCCATCAAGCAAAAGTATGGCAACAAGATCTCTTGGGCCGATCTCATCCTCCTCGCCGGCAACGTCGCC
CTCGAGTCCATGGACTTTGAGCCCATTGGCTTTGGCGCTGGCCGTGCCGACACCTGGCAATCTGACGAATCCGTCTACTGGGGTGCAGAGACCACATTTGTCCCCAAGGGCAACGACGTC
CGCTACAACGGCAGCAAGGACGTTGTCGATCGTGCTGACAAGCTCGAGAAGCCTCTTGGGGCTGTCTCTCTGGGCCTTATCTATGTGAACCCCGAGGGACCTGATGCTAACTCTAACCCT
GCTGATTCCGCTTTGGATATTCGTGTCAACTTTGACCGTATGGGTATGAACGATGAGGAGACTGTTGCTCTCATTGTTGGTGGTCACACCTTTGGCAAAACCCACGGCGCTGTTCCTGGT
T
CCAACATTGGTCCCGAGCCCGAGGCTGCTGACCTTGGTGAGATGGGCCTGGGATGGCACAACAAGGTCGGTGAGGGTAACGGCCCCAACCAGATGACCAGTGGACTTGAGGTCATCTGG
ACCAAGACCCCTACCAA
GTGGAGCAACGGCTTCCTCACCAGTCTTCTCACCAACAACTGGACCCTCGTCGAGAGCCCTGCTGGCGCCCATCAATGGGAAGCCCTCAACGGCACAGTCGAC
TACCCCGATCCCTTTGACAAGACCAAGTTCCGCCGCGCCACCATGCTGACTAGCGACCTTGCTCTCATCCACGACCCTGAGTACCTCAAGATCTGCAAGCGCTGGCAGAAGAACCCCGAG
GAGCTCCGCAAGGCATTTGGCCGCGCCTGGTTCAAGCTTCTCCACCGTGATCTTGGCCCCGTTTCTCGCTACCAGGGCCCTGAGGTTCCTAAGGAGAAGTTTACTTGGCAAGATCCTCTT
CCCGAGCGCAAGGGTGATGTCATTGGTGATGATGATATTGCCACTCTGAAGGCTGAGCTGCTTGCTGCCAAGGGTCTTGGTGTTTCCAAGCTTGTTTCCACCGCTTGGAATGCTGCTTCC
ACCTTCCGTAACTCCGATAAGCGTGGTGGTGCCAACGGTGCTCGCATTGCTCTTAAGCCTCAGCGCAGCTGGGCTAGCAACAACCCTGAGCAGCTTGAGCAGGTTCTTAGCGCCCTCAAG
GCCATACAGAAGAAGTTCAACTCTGGATACAAGACCAAGCAGGTTTCCCTGGCTGATCTGATCGTCCTCGGTGGTGTTGCCGCCGTCGAGAAGGCTGCTCACGATGCTGGTTTCAAGGAT
ATCAAGGTCCCTTTCACCCCTGGTCGTGTCGACGCCACTCAGGACCAGACTGATGTCCGATCTTTCGGTTTCCTCGAGCCTATTGCTGACGGATTCCGCAACTACGGCCATGGAACCGCT
CGCGCCCGTACCGAGGAGCTCCTTGTCGATAAGGCGGCCCTCCTCACCCTGACTCCTCCCGAGCTGACCGTCCTCGTCGGCGGTCTCCGCGCCCTCAACGCCAACTTTGACGGCTCTTCA
AAGGGTATTCTCACCACCAAGAAGGGCCAGCTCACCAATGACTTCTTTGTCAACCTCCTCGACGCCGCCACGGTTTGGACCAAGCAGGACTCCCAGGGTGAGCTCTGGACCGGCACCGAC
CGCAAGACTAAGGCCAAGAAGTGGACTGCTACTCGTGCTGATCTTGTCTTTGGATCACACGCCGAGCTTCGGGCCATTTCCGAGGTTTACGGCAGCGCGGATGCCAAGGAGAAGTTTGTC
AAGGACTTTGTTGCCACTTGGGACAAGGTCATGAACTTGGACCGTTTTGATGTCAAGGCCAAGAACTAG

Retrieve as FASTA